Robuta

https://www.nist.gov/oam/technologies-sustainable-manufacturing-pulp-and-paper-products Technologies for Sustainable Manufacturing of Pulp and Paper Products | NIST Apr 17, 2019 - Goal: Develop six detailed, shared-vision roadmaps for research and development of breakthrough technologies for pulp and paper productssustainable manufacturingtechnologiesnist https://www.sap.com/mena-ar/products/scm/partners/camelot-itlab-gmbh-camelot-sustainable-manufacturing-smart-energy.html Camelot ITLab GmbH | Camelot Sustainable Manufacturing - Smart Energy Smartly analyze and improve your energy usage on the shopfloor sustainable manufacturingcamelotgmbhsmartenergy https://global.fujitsu/se-se/uvance/sustainable-manufacturing Sustainable Manufacturing - Fujitsu Uvance | Fujitsu Sweden With human-centered thinking and advanced digital twins, we will provide a new paradigm shift in the manufacturing industry and realize an integrated and... sustainable manufacturingfujitsu uvancesweden https://hssmi.com/ A Sustainable Manufacturing Consultancy - HSSMI Feb 9, 2026 - Sustainable manufacturing consultancy helping manufacturers to scale up and transition to circular economy practices. sustainable manufacturingconsultancy https://store.astm.org/ssms1902-eb.html Smart and Sustainable Manufacturing Systems sustainable manufacturingsmartsystems https://www.sap.com/australia/products/scm/partners/camelot-itlab-gmbh-camelot-sustainable-manufacturing-smart-energy.html Camelot ITLab GmbH | Camelot Sustainable Manufacturing - Smart Energy Smartly analyze and improve your energy usage on the shopfloor sustainable manufacturingcamelotgmbhsmartenergy https://www.sap.com/lithuania/resources/what-is-sustainable-manufacturing Sustainable Manufacturing: The Future of Industry | SAP Sustainable manufacturing is the practice of designing, manufacturing, and operating products and processes in a way that minimizes environmental impact. the future ofsustainable manufacturingindustrysap https://www.mckinsey.com/industries/industrials/our-insights/the-titanium-economy-capturing-opportunities-in-the-energy-transition Capturing opportunities in sustainable manufacturing | McKinsey Industrial technology companies will play a key role in shaping the future of sustainable manufacturing and accelerating the energy transition. sustainable manufacturingcapturingopportunitiesmckinsey https://www.teamviewer.com/tr/insights/sustainable-manufacturing-efficiency-helps-environment/?language-switched=true Sustainable manufacturing: How your efficiency helps the environment | TeamViewer Dec 18, 2025 - Explore sustainable manufacturing with TeamViewer: boost efficiency, cut costs, streamline operations, and tackle climate change. Explore innovative solutions... sustainable manufacturingthe environmentefficiencyhelpsteamviewer https://my.matterport.com/show/?m=wHBbPf1whvn Sustainable Manufacturing Lab - Matterport 3D Showcase Matterport 3D Showcase. Europastrasse 9, Sustainable Manufacturing Lab, 39031 Bruneck (BZ), IT. sustainable manufacturinglabmatterportshowcase https://cfo.economictimes.indiatimes.com/tag/sustainable+manufacturing Sustainable manufacturing - Latest sustainable manufacturing , Information & Updates - CFO -ETCFO ETCFO.com brings latest sustainable manufacturing news, views and updates from all top sources for the Indian CFO industry. sustainable manufacturinglatest informationupdatescfo https://www.deloitte.com/ke/en/Industries/energy/blogs/sustainable-manufacturing-fixing-factory-floor.html Sustainable manufacturing: Fixing the factory floor | Deloitte Manufacturers can no longer confine sustainability to aspirational targets printed in their annual reports. To make the necessary progress, they will instead... the factory floorsustainable manufacturingfixingdeloitte https://www.hssmi.org/ A Sustainable Manufacturing Consultancy - HSSMI Aug 2, 2023 - We are a sustainable manufacturing consultancy. Our expertise areas include battery technologies, circular economy, digital manufacturing tools, hydrogen... sustainable manufacturingconsultancy https://blogs.nvidia.com/blog/digital-twins-sustainable-manufacturing/ Sustainable Manufacturing and Design: How Digital Twins Are Driving Efficiency and Cutting... Dec 12, 2024 - Siemens and NVIDIA are at the forefront of developing technologies that help customers achieve their sustainability goals and improve production processes. manufacturing and designdigital twinssustainable https://global.fujitsu/en-caribbean/uvance/sustainable-manufacturing Sustainable Manufacturing - Fujitsu Uvance | Fujitsu Caribbean With human-centered thinking and advanced digital twins, we will provide a new paradigm shift in the manufacturing industry and realize an integrated and... sustainable manufacturingfujitsu uvancecaribbean https://publica.fraunhofer.de/entities/event/2651e945-1fcc-4ccc-9f88-6cfb048ba8c0 Global Conference on Sustainable Manufacturing (GCSM) 2017 global conferencesustainable manufacturinggcsm https://www.sap.com/italy/products/scm/partners/camelot-itlab-gmbh-camelot-sustainable-manufacturing-smart-energy.html Camelot ITLab GmbH | Camelot Sustainable Manufacturing - Smart Energy Smartly analyze and improve your energy usage on the shopfloor sustainable manufacturingcamelotgmbhsmartenergy https://manufacturing.economictimes.indiatimes.com/tag/sustainable+manufacturing+biotechnology Sustainable manufacturing biotechnology - Latest sustainable manufacturing biotechnology ,... ETManufacturing.in brings latest sustainable manufacturing biotechnology news, views and updates from all top sources for the Indian Manufacturing industry. sustainable manufacturingbiotechnologylatest https://blogs.sw.siemens.com/valor/2023/07/17/teamwork-and-creativity-for-sustainable-manufacturing/ Teamwork and creativity for sustainable manufacturing - Valor Mar 26, 2026 - Creating a more sustainable manufacturing environment is essential for the future of our planet. It is not just the responsibility of one department or one sustainable manufacturingteamworkcreativityvalor https://www.nist.gov/publications/procedure-developing-key-performance-indicators-sustainable-manufacturing PROCEDURE FOR DEVELOPING KEY PERFORMANCE INDICATORS FOR SUSTAINABLE MANUFACTURING | NIST Sep 30, 2020 - The need for an open, inclusive, and neutral procedure for developing key performance indicators (KPIs) has been increasing as manufacturers seek to determine w key performance indicatorssustainable manufacturingproceduredevelopingnist https://blogs.sw.siemens.com/thought-leadership/the-business-case-for-sustainability-takeaways-from-the-sustainable-manufacturing-expo/ The business case for sustainability: Takeaways from the sustainable manufacturing expo - Thought... Mar 26, 2026 - Last week, I had the opportunity to attend the Sustainable Manufacturing Expo (SME) in Anaheim, California. The event showcased strategies and opportunities the business casefor sustainabilitysustainable manufacturing https://smsrl.uic.edu/ Sustainable Manufacturing Systems Research Laboratory | University of Illinois Chicago university of illinoissustainable manufacturingsystems researchlaboratorychicago https://kailongtec.en.made-in-china.com/product/eYLUpUEBuRcr/China-Sustainable-Manufacturing-High-Quality-Catalyst-Processes-Conserving-Resources.html Sustainable-Manufacturing High Quality Catalyst Processes Conserving Resources - Catalyst and Doc... Sustainable-Manufacturing High Quality Catalyst Processes Conserving Resources, Find Details and Price about Catalyst Doc Substrate Catalyst from... sustainable manufacturinghigh qualityconserving resourcescatalystprocesses https://www.mdmwest.com/education/sustainable-manufacturing-conference/ Join the Sustainable Manufacturing Conference | MD&M West join thesustainable manufacturingconferencemdwest https://smsrl.uic.edu/publications/ Publications | Sustainable Manufacturing Systems Research Laboratory | University of Illinois... sustainable manufacturingsystems researchuniversity ofpublicationslaboratory https://www.deloitte.com/et/en/Industries/energy/blogs/sustainable-manufacturing-fixing-factory-floor.html Sustainable manufacturing: Fixing the factory floor | Deloitte Manufacturers can no longer confine sustainability to aspirational targets printed in their annual reports. To make the necessary progress, they will instead... the factory floorsustainable manufacturingfixingdeloitte https://www.cordis.europa.eu/project/id/608022 Sustainable Manufacturing through Advanced Robotics Training in Europe | SMART-E | Project | Fact... The proposed training network will prepare the next generation of leading Advanced Roboticists to secure a Sustainable Manufacturing (SMART-E) sector in... sustainable manufacturingadvanced robotics https://www.teamviewer.com/ams/insights/sustainable-manufacturing-efficiency-helps-environment/?language-switched=true Sustainable manufacturing: How your efficiency helps the environment | TeamViewer Dec 17, 2025 - Explore sustainable manufacturing with TeamViewer: boost efficiency, cut costs, streamline operations, and tackle climate change. Explore innovative solutions... sustainable manufacturingthe environmentefficiencyhelpsteamviewer https://cobaimpact.com/ Coba Impact | Sustainable Manufacturing & Recycling Jan 10, 2026 - Coba Impact provides sustainable manufacturing and recycling solutions in Ethiopia, producing PET flakes, fibers, and eco-friendly brooms. sustainable manufacturingcobaimpactrecycling https://www.cnr.it/it/progetti-di-ricerca/progetto/45420/er4smus-energy-router-for-sustainable-manufacturing-systems-dit-ad017-137 ER4SMuS - Energy Router For Sustainable Manufacturing Systems (DIT.AD017.137) | Consiglio Nazionale... sustainable manufacturing https://ecoactions.homedepot.com/blog/tag/sustainable-manufacturing/ sustainable manufacturing Archives - Eco Actions sustainable manufacturingarchivesecoactions https://www.sap.com/mena/resources/what-is-sustainable-manufacturing Sustainable Manufacturing: The Future of Industry | SAP Sustainable manufacturing is the practice of designing, manufacturing, and operating products and processes in a way that minimizes environmental impact. the future ofsustainable manufacturingindustrysap https://www.capgemini.com/be-en/insights/expert-perspectives/a-nobel-prize-for-the-planet-metal-organic-frameworks-quantum-computing-and-the-future-of-materials-design/ Quantum Innovations in Sustainable Manufacturing - Capgemini Belgium Oct 29, 2025 - Explore the future of materials with quantum breakthroughs. Discover how metal-organic frameworks are reshaping industries. sustainable manufacturingquantuminnovationscapgeminibelgium https://www.sap.com/netherlands/products/scm/partners/camelot-itlab-gmbh-camelot-sustainable-manufacturing-smart-energy.html Camelot ITLab GmbH | Camelot Sustainable Manufacturing - Smart Energy Smartly analyze and improve your energy usage on the shopfloor sustainable manufacturingcamelotgmbhsmartenergy https://www.deloitte.com/ng/en/Industries/energy/perspectives/sustainable-manufacturing.html Sustainable Manufacturing | Deloitte | ER&I The manufacturing sector has so far not been seen as one that is conflated with environmental best practices. sustainable manufacturingdeloitteer https://www.mdpi.com/2071-1050/16/4/1364 A Framework for Sustainable Manufacturing: Integrating Industry 4.0 Technologies with Industry 5.0... The limitations imposed by resource scarcity and the imperative to mitigate adverse environmental and societal impacts have intensified the urgency of... sustainable manufacturing https://www.sap.com/germany/products/scm/partners/camelot-itlab-gmbh-camelot-sustainable-manufacturing-smart-energy.html Camelot ITLab GmbH | Camelot Sustainable Manufacturing - Smart Energy Smartly analyze and improve your energy usage on the shopfloor sustainable manufacturingcamelotgmbhsmartenergy https://www.deloitte.com/ce/en/industries/energy/blogs/sustainable-manufacturing-fixing-factory-floor.html Sustainable manufacturing: Fixing the factory floor | Deloitte Manufacturers can no longer confine sustainability to aspirational targets printed in their annual reports. To make the necessary progress, they will instead... the factory floorsustainable manufacturingfixingdeloitte https://www.elsevier.com/en-in/insights/sustainable-manufacturing Insights on Sustainable Manufacturing | Elsevier Discover ways to minimize environmental impact, conserve resources, reduce waste and foster innovation. sustainable manufacturinginsightselsevier https://www.centreforsmart.co.uk/ SMART - Sustainable Manufacturing & Recycling Technologies | SMART - Sustainable Manufacturing &... SMART (Sustainable Manufacturing and Recycling Technologies) aims to develop strategies and technologies for a sustainable approach to design, production,... smart sustainablemanufacturingrecyclingtechnologies https://www.sap.com/canada/resources/what-is-sustainable-manufacturing Sustainable Manufacturing: The Future of Industry | SAP Sustainable manufacturing is the practice of designing, manufacturing, and operating products and processes in a way that minimizes environmental impact. the future ofsustainable manufacturingindustrysap https://webflow.com/made-in-webflow/sustainable%20manufacturing Best Sustainable Manufacturing Websites | Free Examples & Designs - Webflow Discover the best sustainable manufacturing websites created by professional designers. Get inspired and start planning your perfect sustainable manufacturing... sustainable manufacturingwebsites freebestexamplesdesigns https://gssd.mit.edu/search-gssd/site/modeling-simulation-sustainable-61155-mon-10-31-2016-0047 Modeling and Simulation for Sustainable Manufacturing | Global System for Sustainable Development modeling and simulationsustainable manufacturingglobal systemdevelopment https://5axislaser925.b-cdn.net/achieving-sustainable-manufacturing-with-high-volume-injection-molding.html Achieving Sustainable Manufacturing with High Volume Injection Molding Understanding High Volume Injection Molding The Basics of Injection Molding High volume injection molding serves as a cornerstone in the production of plastic... sustainable manufacturinghigh volumeachievinginjectionmolding https://research.gatech.edu/taxonomy/term/2637 Sustainable Manufacturing | Research sustainable manufacturingresearch https://www.capgemini.com/in-en/insights/expert-perspectives/a-nobel-prize-for-the-planet-metal-organic-frameworks-quantum-computing-and-the-future-of-materials-design/ Quantum Innovations in Sustainable Manufacturing - Capgemini India Jan 22, 2026 - Explore the future of materials with quantum breakthroughs. Discover how metal-organic frameworks are reshaping industries. sustainable manufacturingquantuminnovationscapgeminiindia https://www.capgemini.com/ca-en/insights/expert-perspectives/a-nobel-prize-for-the-planet-metal-organic-frameworks-quantum-computing-and-the-future-of-materials-design/ Quantum Innovations in Sustainable Manufacturing - Capgemini Canada - English May 5, 2026 - Explore the future of materials with quantum breakthroughs. Discover how metal-organic frameworks are reshaping industries. sustainable manufacturingquantuminnovationscapgeminicanada https://ciosea.economictimes.indiatimes.com/tag/sustainable+manufacturing Sustainable manufacturing - Latest sustainable manufacturing , Information & Updates - CIOSEA -ET... ETCIO.com brings latest sustainable manufacturing news, views and updates from all top sources for the Indian CIOSEA industry. sustainable manufacturinglatest informationupdatescioseaet https://www.sap.com/france/products/scm/partners/camelot-itlab-gmbh-camelot-sustainable-manufacturing-smart-energy.html Camelot ITLab GmbH | Camelot Sustainable Manufacturing - Smart Energy Smartly analyze and improve your energy usage on the shopfloor sustainable manufacturingcamelotgmbhsmartenergy https://www.ornl.gov/group/sustainable-manufacturing-technologies Sustainable Manufacturing Technologies | ORNL sustainable manufacturingtechnologiesornl https://www.nist.gov/publications/modeling-and-simulation-analysis-types-sustainable-manufacturing Modeling and Simulation Analysis Types for Sustainable Manufacturing | NIST modeling and simulationanalysis typessustainable manufacturingnist https://www.deloitte.com/ch/en/Industries/industrial-construction/research/sustainability-in-the-manufacturing-sector.html?icid=toggle_ch_en Sustainable Manufacturing | Deloitte Switzerland The manufacturing sector has so far not been seen as one that is conflated with environmental best practices. sustainable manufacturingdeloitteswitzerland https://www.mec.ed.tum.de/en/iwb/departments/sustainable-manufacturing/ Sustainable Manufacturing - Institute for Machine Tools and Industrial Management sustainable manufacturinginstitute formachine toolsindustrialmanagement https://scholars.uky.edu/en/publications/a-review-of-engineering-research-in-sustainable-manufacturing-2/fingerprints/ A review of engineering research in sustainable manufacturing - Fingerprint - University of Kentucky a reviewengineering researchsustainable manufacturing https://www.mdpi.com/2073-8994/9/7/116 The Fuzzy u-Chart for Sustainable Manufacturing in the Vietnam Textile Dyeing Industry The inevitability of measurement errors and/or humans of subjectivity in data collection processes make accumulated data imprecise, and are thus called fuzzy... manufacturing in vietnam https://www.hssmi.com/ A Sustainable Manufacturing Consultancy - HSSMI Feb 9, 2026 - Sustainable manufacturing consultancy helping manufacturers to scale up and transition to circular economy practices. sustainable manufacturingconsultancy https://www.mcgill.ca/channels/category/tags/sustainable-manufacturing sustainable manufacturing | Channels - McGill University sustainable manufacturingchannelsmcgilluniversity https://www.mdpi.com/2071-1050/13/18/10051 Sustainable Manufacturing Practices, Competitive Capabilities, and Sustainable Performance:... Research highlights the increasing engagement of SMEs in adopting sustainable practices to enhance their sustainable performance. This paper extends the... sustainable manufacturingpracticescompetitivecapabilitiesperformance https://www.deloitte.com/ng/en/Industries/energy/perspectives/sustainable-manufacturing.html?icid=learn_more_content_click Sustainable Manufacturing | Deloitte | ER&I The manufacturing sector has so far not been seen as one that is conflated with environmental best practices. sustainable manufacturingdeloitteer https://www.sap.com/hungary/products/scm/partners/camelot-itlab-gmbh-camelot-sustainable-manufacturing-smart-energy.html Camelot ITLab GmbH | Camelot Sustainable Manufacturing - Smart Energy Smartly analyze and improve your energy usage on the shopfloor sustainable manufacturingcamelotgmbhsmartenergy https://scholars.uky.edu/en/projects/partnership-for-research-and-innovation-in-sustainable-manufactur-3/ Partnership for Research and Innovation in Sustainable Manufacturing (PRISM): Product, Process and... research and innovationsustainable manufacturingpartnership https://www.prnewswire.com/in/news-releases/hygenco-and-stl-pioneer-sustainable-manufacturing-in-the-optical-fibre-industry-302507719.html Hygenco and STL Pioneer Sustainable Manufacturing in the Optical Fibre Industry /PRNewswire/ -- Hygenco Green Energies has commissioned Maharashtra's first green hydrogen and green oxygen production facility in Chhatrapati Sambhaji... sustainable manufacturingthe opticalstlpioneer https://www.sap.com/lithuania/products/scm/partners/camelot-itlab-gmbh-camelot-sustainable-manufacturing-smart-energy.html Camelot ITLab GmbH | Camelot Sustainable Manufacturing - Smart Energy Smartly analyze and improve your energy usage on the shopfloor sustainable manufacturingcamelotgmbhsmartenergy https://www.sap.com/spain/products/scm/partners/camelot-itlab-gmbh-camelot-sustainable-manufacturing-smart-energy.html Camelot ITLab GmbH | Camelot Sustainable Manufacturing - Smart Energy Smartly analyze and improve your energy usage on the shopfloor sustainable manufacturingcamelotgmbhsmartenergy https://www.sap.com/belgique/products/scm/partners/camelot-itlab-gmbh-camelot-sustainable-manufacturing-smart-energy.html Camelot ITLab GmbH | Camelot Sustainable Manufacturing - Smart Energy Smartly analyze and improve your energy usage on the shopfloor sustainable manufacturingcamelotgmbhsmartenergy https://www.deloitte.com/ng/en/Industries/energy/blogs/sustainable-manufacturing-fixing-factory-floor.html Sustainable manufacturing: Fixing the factory floor | Deloitte Manufacturers can no longer confine sustainability to aspirational targets printed in their annual reports. To make the necessary progress, they will instead... the factory floorsustainable manufacturingfixingdeloitte https://retail.economictimes.indiatimes.com/news/apparel-fashion/apparel/aepc-promoting-sustainable-manufacturing-practices-in-garment-clusters-to-boost-exports/100245811 AEPC promoting sustainable manufacturing practices in garment clusters to boost exports, ETRetail Aepc: The council is informing the industry about adopting sustainability practices such as ways to promote water and energy conservation, waste water... sustainable manufacturing https://bamboopellet.in/ Bamboo Pellet Making Machines | Learn About Uses, Manufacturing & Sustainable Solutions Mar 22, 2025 - A detailed description about uses of bamboo pellets as a renewable energy source. learn aboutbamboopelletmakingmachines https://venttup.com/ Venttup: Sustainable Manufacturing venttupsustainablemanufacturing https://gcsm.eu/ GCSM - 22nd Global Conference on Sustainable Manufacturing Dec 1, 2025 - The Technical University of Berlin, Fraunhofer IPK, and the University of Moratuwa cordially invite you to the 22nd GCSM in Colombo global conferencegcsmsustainablemanufacturing https://pure.psu.edu/en/publications/strategies-and-practices-for-inclusive-manufacturing-twenty-first/ Strategies and practices for inclusive manufacturing: twenty-first-century sustainable... first centurystrategiespracticesinclusivemanufacturing https://www.prnewswire.com/news-releases/terrepower-hits-new-milestone-in-sustainable-manufacturing-with-a-50-mw-solar-lot-302695169.html TERREPOWER Hits New Milestone in Sustainable Manufacturing with a 50 MW Solar Lot /PRNewswire/ -- TERREPOWER, formerly BBB Industries, a global pure-play aftermarket leader in sustainable manufacturing, today announced a major expansion of... https://sheffield.ac.uk/news/university-sheffield-partner-new-sustainable-manufacturing-hubs University of Sheffield to partner in new sustainable manufacturing hubs | News | The University of... Four new research hubs aiming to address the challenge of commercialising early stage research within key areas of manufacturing, such as aerospace, medicines... university of sheffield https://cordis.europa.eu/project/id/646307/reporting/pl Open access pilot plants for sustainable industrial scale nanocomposites manufacturing based on... Latest report summary open accesspilot plants https://www.hyundai.com/worldwide/en/newsroom/detail/0000000845 Hyundai Motor Group and Singapore Strengthen Joint Research in Sustainable Energy and Manufacturing... Hyundai Motor Group and Nanyang Technological University, Singapore collaborate in hydrogen energy and advanced energy system hyundai motor group https://colim.co.uk/innovative-industrial-solutions-for-sustainable-manufacturing/ Innovative Industrial Solutions for Sustainable Manufacturing Feb 17, 2026 - Implementing innovative technology at the factory level is no longer just an option but a necessity for long-term survival. industrial solutionsinnovativesustainablemanufacturing https://www.evergreenrecycling.com/ Evergreen Recycling | Sustainable Manufacturing Evergreen Recycling provides cost-effective business solutions for corporate sustainability mandates (CSR) evergreenrecyclingsustainablemanufacturing https://cordis.europa.eu/project/id/968384/reporting Key enabling manufacturing technology for low-cost and sustainable production of fibre-based rigid... Latest report summary https://scholars.uky.edu/es/publications/a-novel-manufacturing-architecture-for-sustainable-value-creation/ A novel manufacturing architecture for sustainable value creation - a novelsustainable valuemanufacturingarchitecturecreation https://paenvironmentdaily.blogspot.com/2017/05/indiana-county-endorses-sustainable.html?m=0 PA Environment Digest Blog: Indiana County Endorses Sustainable Energy, Manufacturing Economic Task... The Indiana Gazette recently reported the Indiana County commissioners gave their blessing to a new Sustainable Economic Development Tas... indiana county https://www.verizon.com/business/en-au/resources/articles/manufacturing/make-manufacturing-even-more-sustainable/ Transform Your Manufacturing with Sustainable Practices & Smart Technologies | Verizon Australia Discover how smart technologies and a robust network can revolutionise your manufacturing for sustainability. Reduce carbon emissions, optimise energy use and... sustainable practicessmart technologiestransformmanufacturingverizon https://ju.diva-portal.org/smash/record.jsf?pid=diva2:1463679 Use of life cycle assessment in sustainable manufacturing : review of literature, analysis and... life cycle assessment https://smulders.com/ Smulders | Manufacturing a sustainable world Smulders is a multidisciplinary construction company with an established reputation in the engineering, production, delivery, and assembly of heavy,... smuldersmanufacturingsustainableworld https://wcma.co.uk/ WCMA | Sustainable British Manufacturing WCMA is a multi-award winning sustainable British manufaturer of promotional products and merchandise. Sustainable British manufacturing for us is the safe... sustainablebritishmanufacturing https://cordis.europa.eu/project/id/280983/es Sustainable Hydrothermal Manufacturing of Nanomaterials | SHYMAN | Proyecto | Ficha informativa |... It is vital that nanomanufacturing routes facilitate an increase in production whilst being 'green', sustainable, low cost and capable of producing high... sustainablehydrothermalmanufacturingnanomaterialsproyecto