https://www.nist.gov/oam/technologies-sustainable-manufacturing-pulp-and-paper-products
Technologies for Sustainable Manufacturing of Pulp and Paper Products | NIST
Apr 17, 2019 - Goal: Develop six detailed, shared-vision roadmaps for research and development of breakthrough technologies for
pulp and paper productssustainable manufacturingtechnologiesnist
https://www.sap.com/mena-ar/products/scm/partners/camelot-itlab-gmbh-camelot-sustainable-manufacturing-smart-energy.html
Camelot ITLab GmbH | Camelot Sustainable Manufacturing - Smart Energy
Smartly analyze and improve your energy usage on the shopfloor
sustainable manufacturingcamelotgmbhsmartenergy
https://global.fujitsu/se-se/uvance/sustainable-manufacturing
Sustainable Manufacturing - Fujitsu Uvance | Fujitsu Sweden
With human-centered thinking and advanced digital twins, we will provide a new paradigm shift in the manufacturing industry and realize an integrated and...
sustainable manufacturingfujitsu uvancesweden
https://hssmi.com/
A Sustainable Manufacturing Consultancy - HSSMI
Feb 9, 2026 - Sustainable manufacturing consultancy helping manufacturers to scale up and transition to circular economy practices.
sustainable manufacturingconsultancy
https://store.astm.org/ssms1902-eb.html
Smart and Sustainable Manufacturing Systems
sustainable manufacturingsmartsystems
https://www.sap.com/australia/products/scm/partners/camelot-itlab-gmbh-camelot-sustainable-manufacturing-smart-energy.html
Camelot ITLab GmbH | Camelot Sustainable Manufacturing - Smart Energy
Smartly analyze and improve your energy usage on the shopfloor
sustainable manufacturingcamelotgmbhsmartenergy
https://www.sap.com/lithuania/resources/what-is-sustainable-manufacturing
Sustainable Manufacturing: The Future of Industry | SAP
Sustainable manufacturing is the practice of designing, manufacturing, and operating products and processes in a way that minimizes environmental impact.
the future ofsustainable manufacturingindustrysap
https://www.mckinsey.com/industries/industrials/our-insights/the-titanium-economy-capturing-opportunities-in-the-energy-transition
Capturing opportunities in sustainable manufacturing | McKinsey
Industrial technology companies will play a key role in shaping the future of sustainable manufacturing and accelerating the energy transition.
sustainable manufacturingcapturingopportunitiesmckinsey
https://www.teamviewer.com/tr/insights/sustainable-manufacturing-efficiency-helps-environment/?language-switched=true
Sustainable manufacturing: How your efficiency helps the environment | TeamViewer
Dec 18, 2025 - Explore sustainable manufacturing with TeamViewer: boost efficiency, cut costs, streamline operations, and tackle climate change. Explore innovative solutions...
sustainable manufacturingthe environmentefficiencyhelpsteamviewer
https://my.matterport.com/show/?m=wHBbPf1whvn
Sustainable Manufacturing Lab - Matterport 3D Showcase
Matterport 3D Showcase. Europastrasse 9, Sustainable Manufacturing Lab, 39031 Bruneck (BZ), IT.
sustainable manufacturinglabmatterportshowcase
https://cfo.economictimes.indiatimes.com/tag/sustainable+manufacturing
Sustainable manufacturing - Latest sustainable manufacturing , Information & Updates - CFO -ETCFO
ETCFO.com brings latest sustainable manufacturing news, views and updates from all top sources for the Indian CFO industry.
sustainable manufacturinglatest informationupdatescfo
https://www.deloitte.com/ke/en/Industries/energy/blogs/sustainable-manufacturing-fixing-factory-floor.html
Sustainable manufacturing: Fixing the factory floor | Deloitte
Manufacturers can no longer confine sustainability to aspirational targets printed in their annual reports. To make the necessary progress, they will instead...
the factory floorsustainable manufacturingfixingdeloitte
https://www.hssmi.org/
A Sustainable Manufacturing Consultancy - HSSMI
Aug 2, 2023 - We are a sustainable manufacturing consultancy. Our expertise areas include battery technologies, circular economy, digital manufacturing tools, hydrogen...
sustainable manufacturingconsultancy
https://blogs.nvidia.com/blog/digital-twins-sustainable-manufacturing/
Sustainable Manufacturing and Design: How Digital Twins Are Driving Efficiency and Cutting...
Dec 12, 2024 - Siemens and NVIDIA are at the forefront of developing technologies that help customers achieve their sustainability goals and improve production processes.
manufacturing and designdigital twinssustainable
https://global.fujitsu/en-caribbean/uvance/sustainable-manufacturing
Sustainable Manufacturing - Fujitsu Uvance | Fujitsu Caribbean
With human-centered thinking and advanced digital twins, we will provide a new paradigm shift in the manufacturing industry and realize an integrated and...
sustainable manufacturingfujitsu uvancecaribbean
https://publica.fraunhofer.de/entities/event/2651e945-1fcc-4ccc-9f88-6cfb048ba8c0
Global Conference on Sustainable Manufacturing (GCSM) 2017
global conferencesustainable manufacturinggcsm
https://www.sap.com/italy/products/scm/partners/camelot-itlab-gmbh-camelot-sustainable-manufacturing-smart-energy.html
Camelot ITLab GmbH | Camelot Sustainable Manufacturing - Smart Energy
Smartly analyze and improve your energy usage on the shopfloor
sustainable manufacturingcamelotgmbhsmartenergy
https://manufacturing.economictimes.indiatimes.com/tag/sustainable+manufacturing+biotechnology
Sustainable manufacturing biotechnology - Latest sustainable manufacturing biotechnology ,...
ETManufacturing.in brings latest sustainable manufacturing biotechnology news, views and updates from all top sources for the Indian Manufacturing industry.
sustainable manufacturingbiotechnologylatest
https://blogs.sw.siemens.com/valor/2023/07/17/teamwork-and-creativity-for-sustainable-manufacturing/
Teamwork and creativity for sustainable manufacturing - Valor
Mar 26, 2026 - Creating a more sustainable manufacturing environment is essential for the future of our planet. It is not just the responsibility of one department or one
sustainable manufacturingteamworkcreativityvalor
https://www.nist.gov/publications/procedure-developing-key-performance-indicators-sustainable-manufacturing
PROCEDURE FOR DEVELOPING KEY PERFORMANCE INDICATORS FOR SUSTAINABLE MANUFACTURING | NIST
Sep 30, 2020 - The need for an open, inclusive, and neutral procedure for developing key performance indicators (KPIs) has been increasing as manufacturers seek to determine w
key performance indicatorssustainable manufacturingproceduredevelopingnist
https://blogs.sw.siemens.com/thought-leadership/the-business-case-for-sustainability-takeaways-from-the-sustainable-manufacturing-expo/
The business case for sustainability: Takeaways from the sustainable manufacturing expo - Thought...
Mar 26, 2026 - Last week, I had the opportunity to attend the Sustainable Manufacturing Expo (SME) in Anaheim, California. The event showcased strategies and opportunities
the business casefor sustainabilitysustainable manufacturing
https://smsrl.uic.edu/
Sustainable Manufacturing Systems Research Laboratory | University of Illinois Chicago
university of illinoissustainable manufacturingsystems researchlaboratorychicago
https://kailongtec.en.made-in-china.com/product/eYLUpUEBuRcr/China-Sustainable-Manufacturing-High-Quality-Catalyst-Processes-Conserving-Resources.html
Sustainable-Manufacturing High Quality Catalyst Processes Conserving Resources - Catalyst and Doc...
Sustainable-Manufacturing High Quality Catalyst Processes Conserving Resources, Find Details and Price about Catalyst Doc Substrate Catalyst from...
sustainable manufacturinghigh qualityconserving resourcescatalystprocesses
https://www.mdmwest.com/education/sustainable-manufacturing-conference/
Join the Sustainable Manufacturing Conference | MD&M West
join thesustainable manufacturingconferencemdwest
https://smsrl.uic.edu/publications/
Publications | Sustainable Manufacturing Systems Research Laboratory | University of Illinois...
sustainable manufacturingsystems researchuniversity ofpublicationslaboratory
https://www.deloitte.com/et/en/Industries/energy/blogs/sustainable-manufacturing-fixing-factory-floor.html
Sustainable manufacturing: Fixing the factory floor | Deloitte
Manufacturers can no longer confine sustainability to aspirational targets printed in their annual reports. To make the necessary progress, they will instead...
the factory floorsustainable manufacturingfixingdeloitte
https://www.cordis.europa.eu/project/id/608022
Sustainable Manufacturing through Advanced Robotics Training in Europe | SMART-E | Project | Fact...
The proposed training network will prepare the next generation of leading Advanced Roboticists to secure a Sustainable Manufacturing (SMART-E) sector in...
sustainable manufacturingadvanced robotics
https://www.teamviewer.com/ams/insights/sustainable-manufacturing-efficiency-helps-environment/?language-switched=true
Sustainable manufacturing: How your efficiency helps the environment | TeamViewer
Dec 17, 2025 - Explore sustainable manufacturing with TeamViewer: boost efficiency, cut costs, streamline operations, and tackle climate change. Explore innovative solutions...
sustainable manufacturingthe environmentefficiencyhelpsteamviewer
https://cobaimpact.com/
Coba Impact | Sustainable Manufacturing & Recycling
Jan 10, 2026 - Coba Impact provides sustainable manufacturing and recycling solutions in Ethiopia, producing PET flakes, fibers, and eco-friendly brooms.
sustainable manufacturingcobaimpactrecycling
https://www.cnr.it/it/progetti-di-ricerca/progetto/45420/er4smus-energy-router-for-sustainable-manufacturing-systems-dit-ad017-137
ER4SMuS - Energy Router For Sustainable Manufacturing Systems (DIT.AD017.137) | Consiglio Nazionale...
sustainable manufacturing
https://ecoactions.homedepot.com/blog/tag/sustainable-manufacturing/
sustainable manufacturing Archives - Eco Actions
sustainable manufacturingarchivesecoactions
https://www.sap.com/mena/resources/what-is-sustainable-manufacturing
Sustainable Manufacturing: The Future of Industry | SAP
Sustainable manufacturing is the practice of designing, manufacturing, and operating products and processes in a way that minimizes environmental impact.
the future ofsustainable manufacturingindustrysap
https://www.capgemini.com/be-en/insights/expert-perspectives/a-nobel-prize-for-the-planet-metal-organic-frameworks-quantum-computing-and-the-future-of-materials-design/
Quantum Innovations in Sustainable Manufacturing - Capgemini Belgium
Oct 29, 2025 - Explore the future of materials with quantum breakthroughs. Discover how metal-organic frameworks are reshaping industries.
sustainable manufacturingquantuminnovationscapgeminibelgium
https://www.sap.com/netherlands/products/scm/partners/camelot-itlab-gmbh-camelot-sustainable-manufacturing-smart-energy.html
Camelot ITLab GmbH | Camelot Sustainable Manufacturing - Smart Energy
Smartly analyze and improve your energy usage on the shopfloor
sustainable manufacturingcamelotgmbhsmartenergy
https://www.deloitte.com/ng/en/Industries/energy/perspectives/sustainable-manufacturing.html
Sustainable Manufacturing | Deloitte | ER&I
The manufacturing sector has so far not been seen as one that is conflated with environmental best practices.
sustainable manufacturingdeloitteer
https://www.mdpi.com/2071-1050/16/4/1364
A Framework for Sustainable Manufacturing: Integrating Industry 4.0 Technologies with Industry 5.0...
The limitations imposed by resource scarcity and the imperative to mitigate adverse environmental and societal impacts have intensified the urgency of...
sustainable manufacturing
https://www.sap.com/germany/products/scm/partners/camelot-itlab-gmbh-camelot-sustainable-manufacturing-smart-energy.html
Camelot ITLab GmbH | Camelot Sustainable Manufacturing - Smart Energy
Smartly analyze and improve your energy usage on the shopfloor
sustainable manufacturingcamelotgmbhsmartenergy
https://www.deloitte.com/ce/en/industries/energy/blogs/sustainable-manufacturing-fixing-factory-floor.html
Sustainable manufacturing: Fixing the factory floor | Deloitte
Manufacturers can no longer confine sustainability to aspirational targets printed in their annual reports. To make the necessary progress, they will instead...
the factory floorsustainable manufacturingfixingdeloitte
https://www.elsevier.com/en-in/insights/sustainable-manufacturing
Insights on Sustainable Manufacturing | Elsevier
Discover ways to minimize environmental impact, conserve resources, reduce waste and foster innovation.
sustainable manufacturinginsightselsevier
https://www.centreforsmart.co.uk/
SMART - Sustainable Manufacturing & Recycling Technologies | SMART - Sustainable Manufacturing &...
SMART (Sustainable Manufacturing and Recycling Technologies) aims to develop strategies and technologies for a sustainable approach to design, production,...
smart sustainablemanufacturingrecyclingtechnologies
https://www.sap.com/canada/resources/what-is-sustainable-manufacturing
Sustainable Manufacturing: The Future of Industry | SAP
Sustainable manufacturing is the practice of designing, manufacturing, and operating products and processes in a way that minimizes environmental impact.
the future ofsustainable manufacturingindustrysap
https://webflow.com/made-in-webflow/sustainable%20manufacturing
Best Sustainable Manufacturing Websites | Free Examples & Designs - Webflow
Discover the best sustainable manufacturing websites created by professional designers. Get inspired and start planning your perfect sustainable manufacturing...
sustainable manufacturingwebsites freebestexamplesdesigns
https://gssd.mit.edu/search-gssd/site/modeling-simulation-sustainable-61155-mon-10-31-2016-0047
Modeling and Simulation for Sustainable Manufacturing | Global System for Sustainable Development
modeling and simulationsustainable manufacturingglobal systemdevelopment
https://5axislaser925.b-cdn.net/achieving-sustainable-manufacturing-with-high-volume-injection-molding.html
Achieving Sustainable Manufacturing with High Volume Injection Molding
Understanding High Volume Injection Molding The Basics of Injection Molding High volume injection molding serves as a cornerstone in the production of plastic...
sustainable manufacturinghigh volumeachievinginjectionmolding
https://research.gatech.edu/taxonomy/term/2637
Sustainable Manufacturing | Research
sustainable manufacturingresearch
https://www.capgemini.com/in-en/insights/expert-perspectives/a-nobel-prize-for-the-planet-metal-organic-frameworks-quantum-computing-and-the-future-of-materials-design/
Quantum Innovations in Sustainable Manufacturing - Capgemini India
Jan 22, 2026 - Explore the future of materials with quantum breakthroughs. Discover how metal-organic frameworks are reshaping industries.
sustainable manufacturingquantuminnovationscapgeminiindia
https://www.capgemini.com/ca-en/insights/expert-perspectives/a-nobel-prize-for-the-planet-metal-organic-frameworks-quantum-computing-and-the-future-of-materials-design/
Quantum Innovations in Sustainable Manufacturing - Capgemini Canada - English
May 5, 2026 - Explore the future of materials with quantum breakthroughs. Discover how metal-organic frameworks are reshaping industries.
sustainable manufacturingquantuminnovationscapgeminicanada
https://ciosea.economictimes.indiatimes.com/tag/sustainable+manufacturing
Sustainable manufacturing - Latest sustainable manufacturing , Information & Updates - CIOSEA -ET...
ETCIO.com brings latest sustainable manufacturing news, views and updates from all top sources for the Indian CIOSEA industry.
sustainable manufacturinglatest informationupdatescioseaet
https://www.sap.com/france/products/scm/partners/camelot-itlab-gmbh-camelot-sustainable-manufacturing-smart-energy.html
Camelot ITLab GmbH | Camelot Sustainable Manufacturing - Smart Energy
Smartly analyze and improve your energy usage on the shopfloor
sustainable manufacturingcamelotgmbhsmartenergy
https://www.ornl.gov/group/sustainable-manufacturing-technologies
Sustainable Manufacturing Technologies | ORNL
sustainable manufacturingtechnologiesornl
https://www.nist.gov/publications/modeling-and-simulation-analysis-types-sustainable-manufacturing
Modeling and Simulation Analysis Types for Sustainable Manufacturing | NIST
modeling and simulationanalysis typessustainable manufacturingnist
https://www.deloitte.com/ch/en/Industries/industrial-construction/research/sustainability-in-the-manufacturing-sector.html?icid=toggle_ch_en
Sustainable Manufacturing | Deloitte Switzerland
The manufacturing sector has so far not been seen as one that is conflated with environmental best practices.
sustainable manufacturingdeloitteswitzerland
https://www.mec.ed.tum.de/en/iwb/departments/sustainable-manufacturing/
Sustainable Manufacturing - Institute for Machine Tools and Industrial Management
sustainable manufacturinginstitute formachine toolsindustrialmanagement
https://scholars.uky.edu/en/publications/a-review-of-engineering-research-in-sustainable-manufacturing-2/fingerprints/
A review of engineering research in sustainable manufacturing - Fingerprint - University of Kentucky
a reviewengineering researchsustainable manufacturing
https://www.mdpi.com/2073-8994/9/7/116
The Fuzzy u-Chart for Sustainable Manufacturing in the Vietnam Textile Dyeing Industry
The inevitability of measurement errors and/or humans of subjectivity in data collection processes make accumulated data imprecise, and are thus called fuzzy...
manufacturing in vietnam
https://www.hssmi.com/
A Sustainable Manufacturing Consultancy - HSSMI
Feb 9, 2026 - Sustainable manufacturing consultancy helping manufacturers to scale up and transition to circular economy practices.
sustainable manufacturingconsultancy
https://www.mcgill.ca/channels/category/tags/sustainable-manufacturing
sustainable manufacturing | Channels - McGill University
sustainable manufacturingchannelsmcgilluniversity
https://www.mdpi.com/2071-1050/13/18/10051
Sustainable Manufacturing Practices, Competitive Capabilities, and Sustainable Performance:...
Research highlights the increasing engagement of SMEs in adopting sustainable practices to enhance their sustainable performance. This paper extends the...
sustainable manufacturingpracticescompetitivecapabilitiesperformance
https://www.deloitte.com/ng/en/Industries/energy/perspectives/sustainable-manufacturing.html?icid=learn_more_content_click
Sustainable Manufacturing | Deloitte | ER&I
The manufacturing sector has so far not been seen as one that is conflated with environmental best practices.
sustainable manufacturingdeloitteer
https://www.sap.com/hungary/products/scm/partners/camelot-itlab-gmbh-camelot-sustainable-manufacturing-smart-energy.html
Camelot ITLab GmbH | Camelot Sustainable Manufacturing - Smart Energy
Smartly analyze and improve your energy usage on the shopfloor
sustainable manufacturingcamelotgmbhsmartenergy
https://scholars.uky.edu/en/projects/partnership-for-research-and-innovation-in-sustainable-manufactur-3/
Partnership for Research and Innovation in Sustainable Manufacturing (PRISM): Product, Process and...
research and innovationsustainable manufacturingpartnership
https://www.prnewswire.com/in/news-releases/hygenco-and-stl-pioneer-sustainable-manufacturing-in-the-optical-fibre-industry-302507719.html
Hygenco and STL Pioneer Sustainable Manufacturing in the Optical Fibre Industry
/PRNewswire/ -- Hygenco Green Energies has commissioned Maharashtra's first green hydrogen and green oxygen production facility in Chhatrapati Sambhaji...
sustainable manufacturingthe opticalstlpioneer
https://www.sap.com/lithuania/products/scm/partners/camelot-itlab-gmbh-camelot-sustainable-manufacturing-smart-energy.html
Camelot ITLab GmbH | Camelot Sustainable Manufacturing - Smart Energy
Smartly analyze and improve your energy usage on the shopfloor
sustainable manufacturingcamelotgmbhsmartenergy
https://www.sap.com/spain/products/scm/partners/camelot-itlab-gmbh-camelot-sustainable-manufacturing-smart-energy.html
Camelot ITLab GmbH | Camelot Sustainable Manufacturing - Smart Energy
Smartly analyze and improve your energy usage on the shopfloor
sustainable manufacturingcamelotgmbhsmartenergy
https://www.sap.com/belgique/products/scm/partners/camelot-itlab-gmbh-camelot-sustainable-manufacturing-smart-energy.html
Camelot ITLab GmbH | Camelot Sustainable Manufacturing - Smart Energy
Smartly analyze and improve your energy usage on the shopfloor
sustainable manufacturingcamelotgmbhsmartenergy
https://www.deloitte.com/ng/en/Industries/energy/blogs/sustainable-manufacturing-fixing-factory-floor.html
Sustainable manufacturing: Fixing the factory floor | Deloitte
Manufacturers can no longer confine sustainability to aspirational targets printed in their annual reports. To make the necessary progress, they will instead...
the factory floorsustainable manufacturingfixingdeloitte
https://retail.economictimes.indiatimes.com/news/apparel-fashion/apparel/aepc-promoting-sustainable-manufacturing-practices-in-garment-clusters-to-boost-exports/100245811
AEPC promoting sustainable manufacturing practices in garment clusters to boost exports, ETRetail
Aepc: The council is informing the industry about adopting sustainability practices such as ways to promote water and energy conservation, waste water...
sustainable manufacturing
https://bamboopellet.in/
Bamboo Pellet Making Machines | Learn About Uses, Manufacturing & Sustainable Solutions
Mar 22, 2025 - A detailed description about uses of bamboo pellets as a renewable energy source.
learn aboutbamboopelletmakingmachines
https://venttup.com/
Venttup: Sustainable Manufacturing
venttupsustainablemanufacturing
https://gcsm.eu/
GCSM - 22nd Global Conference on Sustainable Manufacturing
Dec 1, 2025 - The Technical University of Berlin, Fraunhofer IPK, and the University of Moratuwa cordially invite you to the 22nd GCSM in Colombo
global conferencegcsmsustainablemanufacturing
https://pure.psu.edu/en/publications/strategies-and-practices-for-inclusive-manufacturing-twenty-first/
Strategies and practices for inclusive manufacturing: twenty-first-century sustainable...
first centurystrategiespracticesinclusivemanufacturing
https://www.prnewswire.com/news-releases/terrepower-hits-new-milestone-in-sustainable-manufacturing-with-a-50-mw-solar-lot-302695169.html
TERREPOWER Hits New Milestone in Sustainable Manufacturing with a 50 MW Solar Lot
/PRNewswire/ -- TERREPOWER, formerly BBB Industries, a global pure-play aftermarket leader in sustainable manufacturing, today announced a major expansion of...
https://sheffield.ac.uk/news/university-sheffield-partner-new-sustainable-manufacturing-hubs
University of Sheffield to partner in new sustainable manufacturing hubs | News | The University of...
Four new research hubs aiming to address the challenge of commercialising early stage research within key areas of manufacturing, such as aerospace, medicines...
university of sheffield
https://cordis.europa.eu/project/id/646307/reporting/pl
Open access pilot plants for sustainable industrial scale nanocomposites manufacturing based on...
Latest report summary
open accesspilot plants
https://www.hyundai.com/worldwide/en/newsroom/detail/0000000845
Hyundai Motor Group and Singapore Strengthen Joint Research in Sustainable Energy and Manufacturing...
Hyundai Motor Group and Nanyang Technological University, Singapore collaborate in hydrogen energy and advanced energy system
hyundai motor group
https://colim.co.uk/innovative-industrial-solutions-for-sustainable-manufacturing/
Innovative Industrial Solutions for Sustainable Manufacturing
Feb 17, 2026 - Implementing innovative technology at the factory level is no longer just an option but a necessity for long-term survival.
industrial solutionsinnovativesustainablemanufacturing
https://www.evergreenrecycling.com/
Evergreen Recycling | Sustainable Manufacturing
Evergreen Recycling provides cost-effective business solutions for corporate sustainability mandates (CSR)
evergreenrecyclingsustainablemanufacturing
https://cordis.europa.eu/project/id/968384/reporting
Key enabling manufacturing technology for low-cost and sustainable production of fibre-based rigid...
Latest report summary
https://scholars.uky.edu/es/publications/a-novel-manufacturing-architecture-for-sustainable-value-creation/
A novel manufacturing architecture for sustainable value creation -
a novelsustainable valuemanufacturingarchitecturecreation
https://paenvironmentdaily.blogspot.com/2017/05/indiana-county-endorses-sustainable.html?m=0
PA Environment Digest Blog: Indiana County Endorses Sustainable Energy, Manufacturing Economic Task...
The Indiana Gazette recently reported the Indiana County commissioners gave their blessing to a new Sustainable Economic Development Tas...
indiana county
https://www.verizon.com/business/en-au/resources/articles/manufacturing/make-manufacturing-even-more-sustainable/
Transform Your Manufacturing with Sustainable Practices & Smart Technologies | Verizon Australia
Discover how smart technologies and a robust network can revolutionise your manufacturing for sustainability. Reduce carbon emissions, optimise energy use and...
sustainable practicessmart technologiestransformmanufacturingverizon
https://ju.diva-portal.org/smash/record.jsf?pid=diva2:1463679
Use of life cycle assessment in sustainable manufacturing : review of literature, analysis and...
life cycle assessment
https://smulders.com/
Smulders | Manufacturing a sustainable world
Smulders is a multidisciplinary construction company with an established reputation in the engineering, production, delivery, and assembly of heavy,...
smuldersmanufacturingsustainableworld
https://wcma.co.uk/
WCMA | Sustainable British Manufacturing
WCMA is a multi-award winning sustainable British manufaturer of promotional products and merchandise. Sustainable British manufacturing for us is the safe...
sustainablebritishmanufacturing
https://cordis.europa.eu/project/id/280983/es
Sustainable Hydrothermal Manufacturing of Nanomaterials | SHYMAN | Proyecto | Ficha informativa |...
It is vital that nanomanufacturing routes facilitate an increase in production whilst being 'green', sustainable, low cost and capable of producing high...
sustainablehydrothermalmanufacturingnanomaterialsproyecto