https://fairygodboss.com/jobs/northropgrumman/engineer-principal-engineer-systems-architect-8b08ed10c5946ec569f4a8878a7d6af8
Engineer / Principal Engineer Systems Architect at Northrop Grumman in Melbourne, FL | Fairygodboss
Northrop Grumman is actively hiring a Engineer / Principal Engineer Systems Architect in Melbourne, FL . Find out more details about the job description and...
systems architectnorthrop grummanmelbourne flengineerprincipal
https://portfoliocareers.levelequity.com/companies/fivetran/jobs/69422265-sr-principal-ai-systems-architect
Sr. Principal AI Systems Architect @ Fivetran | Level Equity Job Board
Search job openings across the Level Equity network.
ai systemsjob boardsrprincipalarchitect
https://www.maksimmasalski.com/home
Mr. Masalski | Physical AI & Edge Computing | RAG Systems Architect
Bridging the gap between LLMs and local hardware. I create intelligent systems from architecting complex RAG pipelines to optimizing AI at the edge.
ai edge computingrag systemsmrphysicalarchitect
https://jobs.accel.com/companies/nimble-storage-2/jobs/74470838-channel-systems-architect-for-western-canada
Channel Systems Architect for western Canada @ Nimble Storage | Accel Job Board
Search job openings across the Accel network.
channel systemswestern canadanimble storagejob boardarchitect
https://recursiveintelligence.io/
Seth Robins | Industrial AI & Systems Architect
Connecting practical AI and ML methodologies to the latest research. Combating cognitive atrophy and AI misuse with scientific skepticism and rigor.
industrial aisystems architectsethrobins
https://www.clearancejobs.com/jobs/8884752/systems-architect-senior
Systems Architect (Senior) Remote / Telecommute Jobs - ClearanceJobs
Systems Architect (Senior) requiring an active security clearance. Find other Peraton defense and intelligence career opportunities on ClearanceJobs.com
systems architectseniorremotetelecommutejobs
https://jobs.anitab.org/companies/wells-fargo/jobs/76838392-lead-systems-architect-saas-cloud-security
Lead Systems Architect - SaaS & Cloud Security @ Wells Fargo | AnitaB.org Job Board
Join the AnitaB.org Job Board and Talent Network to search for jobs, explore companies, and upload your resume to find opportunities tailored just for you!
lead systemscloud securitywells fargojob boardarchitect
https://hussainjatoi.com/
AI Automation Consultant & Systems Architect | Hussain Jatoi
I build AI automation systems, SEO infrastructure, and digital workflows that run your business around the clock. One expert. Full accountability. No agency...
ai automationsystems architectconsultanthussain
https://www.avclub.com/in-silicon-valley-everyone-is-the-systems-architect-of-1798187865
In Silicon Valley, everyone is the systems architect of their own destruction
In Silicon Valley, everyone is the systems architect of their own destruction
silicon valleythe systemstheir owneveryonearchitect
https://muldoon.design/
Kevin Muldoon | Design Systems Architect & Writer
design systems architectkevinmuldoonwriter
https://daniellee.co.uk/
Daniel Lee | Senior Marketing Leader & AI Systems Architect
Apr 24, 2026 - 15 years driving digital transformation and revenue growth for global brands. From technical SEO to AI-powered marketing operations, I build the systems that
daniel leemarketing leaderai systemsseniorarchitect
https://iadsclick.com/
MarTech Revenue Growth Systems Architect | Advertising, Analytics Global AI & Infrastructure
Global Revenue Systems Architect fixing broken attribution and building zero-leak data infrastructure. We provide AI implementation, MarTech RevOps, and...
revenue growthsystems architectadvertising analyticsglobal aimartech
https://jobs.hiringourheroes.org/jobs/467464570-f-35-systems-architect-senior-staff
F-35 Systems Architect Senior Staff at Lockheed Martin - Hiring Our Heroes Job Board
hiring our heroessystems architectsenior stafflockheed martinjob board
https://www.linkedinliu.com/
Ziping Liu - Professional Portfolio Profile | LinkedIn | AI Systems Architect & Sole Creator of...
Feb 28, 2026 - Ziping Liu is a US-based AI Architect and the sole engineer behind the GaiaGraph decision-intelligence platform. He independently developed the ARC/CRA...
professional portfolioai systemsliuprofilelinkedin
https://careers.thalesgroup.com/es/es/job/R0324935/Computer-Systems-Architect
Electronic Countermeasures (ECM) Systems Architect in Crawley, Reino Unido | Sistemas at Thales...
aplica trabaja con Thales Group in . enThales Group
systems architectreino unidoelectroniccountermeasuresecm
https://www.tonex.com/training-courses/certified-advanced-space-systems-architect-cassa/
Certified Advanced Space Systems Architect (CASSA) - Tonex Training
Certified Advanced Space Systems Architect (CASSA) Certification Program by Tonex prepares experienced engineers and technical leaders to design and oversee...
space systemstonex trainingcertifiedadvancedarchitect
https://jobpromax.com/jobs/rf_systems_architect_control_algorithms_363022
RF Systems Architect - Control Algorithms at Apple | JobProMax | JobProMax
rf systemsarchitectcontrolalgorithmsapple
https://councils.forbes.com/profile/Malar-Mangai-Kondappan-Systems-Architect-/e0d4b08e-c9bc-4094-84be-a5085d954653
Malar Mangai Kondappan | Systems Architect - - | Forbes Technology Council
Find articles by Malar Mangai Kondappan, Systems Architect of - and member of the Forbes Technology Council
forbes technology councilsystems architect
https://careers.redpoint.com/companies/psiquantum/jobs/73994843-principal-power-systems-architect-quantum-infrastructure
Principal Power Systems Architect, Quantum Infrastructure @ PsiQuantum | Redpoint Ventures Job Board
Search job openings across the Redpoint Ventures network.
power systemsquantum infrastructureredpoint venturesjob boardprincipal
https://www.dice.com/job-detail/98d5a344-71ec-4e5a-b9fe-c2058779099a
Advisor Information Systems Architect - ServiceNow - Gainwell Technologies LLC - Austin, TX, US |...
30+ days ago - Be part of a team that unleashes the power of leading-edge technologies to help improve the health and well-being of those most vulnera...
advisor informationsystems architectaustin txservicenowtechnologies
https://blackfoals.com/
BLACKFOALS - IAKIES AKE - Alev Karatay | Epistemic AI Systems Architect
IAKIES - I Alev Karatay Innovation Ecosystem ve AKE - Alev Karatay Epistemology. Epistemic AI Systems Architecture, AGI-oriented cognitive architecture,...
ai systemsakealevkaratayepistemic
https://hitmarker.net/jobs/unity-gtm-operations-and-ai-systems-architect-1703448
GTM Operations and AI Systems Architect - Unity | Hitmarker
Unity is hiring a GTM Operations and AI Systems Architect. Apply now on Hitmarker.
ai systemsgtmoperationsarchitectunity
https://jobs.notablecap.com/companies/workstream-2/jobs/54773456-revenue-systems-architect
Revenue Systems Architect @ Workstream | Notable Capital Job Board
Search job openings across the Notable Capital network.
systems architectnotable capitaljob boardrevenue
https://workingreen.jobs/offers/cockpit-and-cabin-systems-architect-at-vertical-aerospace-bristol
Cockpit and Cabin Systems Architect - Vertical Aerospace |
Job at Vertical Aerospace - Cockpit and Cabin Systems Architect in Bristol, United Kingdom
cabin systemsvertical aerospacecockpitarchitect
https://www.virtusa.com/careers/au/sydney/others/pega-senior-systems-architect
Pega Senior Systems Architect
systems architectpegasenior
https://jobs.unreasonablegroup.com/companies/sungreenh2/jobs/74076660-chipset-systems-architect
Chipset Systems Architect @ SunGreenH2 | Unreasonable Job Board
Search job openings across the Unreasonable network.
systems architectjob boardchipsetunreasonable
https://www.builtincolorado.com/job/senior-marketing-systems-architect/9249905
Senior Marketing Systems Architect - Huntress | Built In Colorado
Huntress is hiring for a Remote Senior Marketing Systems Architect in United States of America. Find more details about the job and how to apply at Built In...
built in coloradosystems architectseniormarketinghuntress
https://www.softwaredevelopment.com.au/
Steve Goodwin | AI Systems Architect & Enterprise Architecture Consultant
AI Systems Architect and Enterprise Architecture Consultant in Brisbane. Designing AI-enabled platforms, agent systems, software architecture, enterprise...
ai systemsenterprise architecturestevegoodwinconsultant
https://jobs.lenovo.com/zh_CN/careers/JobDetail/AI-Systems-Architect/74486
AI Systems Architect - - 74486
ai systemsarchitect
https://www.elsejob.com/jobs/listing/systems-architect
Systems Architect job vacancies | ElseJob
Explore the freshest Systems Architect roles on ElseJob and post your company job listings for free. With ElseJob, connecting with top talent is effortless and...
systems architectjob vacancies
https://www.builtinsf.com/job/staff-storage-systems-architect/8846578
Staff Storage Systems Architect - Lambda | Built In San Francisco
Lambda is hiring for a Staff Storage Systems Architect in San Francisco, CA, USA. Find more details about the job and how to apply at Built In San Francisco.
in san franciscostorage systemsstaffarchitectlambda
https://www.shine.com/job-search/systems-architect-jobs
Systems Architect Jobs - 84,809 Systems Architect Job Vacancies in May 2026
Explore 84,809 Systems Architect jobs at Shine.com. Find your next role in building innovative applications. Browse Systems Architect openings and apply now to...
systems architectjob vacanciesin mayjobs
https://www.spacevibes.org/
SpaceVibes | Systems Architect and Deep Tech Holdings | Inc. Orbital IP and IP for 3D Live Streaming
Teleport anywhere from a first person POV with SpaceVibes Inc. Become eye to eye with the Grand Sphinx, marvel at the textures of The Starry Night, learn...
systems architectdeep techlive streamingholdingsinc
https://www.interviews.chat/star-questions/it-systems-architect
Behavioral Interview Questions for IT Systems Architect (STAR Method Answers)
Explore the most common behavioral interview questions for IT Systems Architect with STAR Method answers to help you prepare and land the job.
behavioral interviewfor itsystems architectstar methodquestions
https://www4.lead411.com/Elizabeth_Albano_32650063.html
Elizabeth Albano | Umpqua Bank | Email, IT Systems Architect
Elizabeth Albanois the IT Systems Architect of . Lead411's profile includes an email address, umpquabank.com, linkedin, biography, etc
umpqua bankit systemselizabethalbanoemail
https://jobs.clevelandtalent.org/companies/heinen-s-grocery-store-2/jobs/76317246-systems-architect
Systems Architect @ Heinen's Grocery Store | Destination Cleveland Job Board
Search job openings across the Destination Cleveland network.
systems architectgrocery storedestination clevelandjob boardheinen
https://pitchmeai.com/jobs/firefly-aerospace/senior-spacecraft-power-systems-architect-r6ismyni3o
Senior Spacecraft Power Systems Architect (Remote) at Firefly Aerospace | Apply at Firefly...
Firefly Aerospace is hiring a Senior Spacecraft Power Systems Architect. Learn how to apply for this exciting remote role and email hiring manager at...
power systemsfirefly aerospaceseniorspacecraftarchitect
https://craigmbrown.com/
Craig Brown | AI Systems Architect
Craig Brown - AI Systems Architect building multi-agent platforms, prediction markets, and privacy-first financial services for AI agents.
craig brownsystems architect
https://jobs.blockchaincapital.com/companies/ripple/jobs/76200602-gtm-systems-architect-ripple-treasury-ai-automation
GTM Systems Architect, Ripple Treasury (AI & Automation) @ Ripple | Blockchain Capital Job Board
Search job openings across the Blockchain Capital network.
systems architectai automationblockchain capitaljob boardgtm
https://www.hireitpeople.com/jobs/2874-virtual-systems-architect
Virtual/Systems Architect - Hire IT People - We get IT done
Short Description: Virtual/Systems Architect will be responsible for the assessment, design and build out of a new virtual and server infrastructure. The...
virtual systemsarchitecthirepeopleget
https://freel.ca/freelancer/matt-king
Matt King - Senior Systems Architect | Ag Tech Developer | CAF Veteran | Freel
matt kingsystems architectag techseniordeveloper
https://neeraz.com/
Neeraz | Full-Stack Dev & Systems Architect
Niraj Chandra Poudel (Neeraz). 10+ years of high-end web development and systems architecture. Based in Nepal, serving the world.
full stack devsystems architect
https://findzambiajobs.com/job/systems-architect-lumwana-mine/
Systems Architect - FZJ | Jobs in Zambia
Apr 21, 2022 - Looking for the latest Systems Architect jobs in Zambia? Search and apply for suitable jobs in Zambia on Find Zambia Jobs. Zambia Jobs.
systems architectjobs infzjzambia
https://careers.qualcomm.com/careers/job/446715272067-systems-architect-sensors-technology-cork-ireland-cork-ireland?domain=qualcomm.com
Systems Architect (Sensors Technology) (Onsite) - Cork, Ireland | Qualcomm
BS Degree required, MS or PhD degree in related field highly desired SOC Architecture background with system design experience involving embedded software on a...
systems architectsensorstechnologyonsitecork
https://careers.franciscopartners.com/companies/forcepoint/jobs/76541605-it-systems-architect
IT Systems Architect @ Forcepoint | Francisco Partners Job Board
Search job openings across the Francisco Partners network.
it systemsfrancisco partnersjob boardarchitectforcepoint
https://www.themuse.com/jobs/apple/cellular-rf-systems-architect-92bba7
Cellular RF Systems Architect at Apple | The Muse | The Muse
Find our Cellular RF Systems Architect job description for Apple located in Newton, MA, as well as other career opportunities that the company is hiring for.
rf systemsthe musecellulararchitectapple
https://jobs.nolavateblack.com/companies/apple/jobs/76664712-cellular-rf-receiver-systems-architect
Cellular RF Receiver Systems Architect @ Apple | Nolavate Black Job Board
Search job openings across the Nolavate Black network.
systems architectjob boardcellularrfreceiver
https://careers.bluewing.vc/companies/anduril/jobs/76915387-lead-electrical-systems-architect-edge-compute-and-communications
Lead Electrical Systems Architect, Edge Compute and Communications @ Anduril | BlueWing Job Board
Search job openings across the BlueWing network.
electrical systemsedge computejob boardleadarchitect
https://coloradospringschamberedc.com/find-a-job/job/software-systems-architect-with-clearance-2/
Software Systems Architect with Clearance - Colorado Springs Chamber & EDC
software systemscolorado springsarchitectclearancechamber
https://www.jobberman.com/listings/ai-systems-architect-technical-operator-d975qw
AI Systems Architect at The Guardian Corps (T.G.Corps) | Jobberman
Apply online for the ai systems architect vacancy at The Guardian Corps (T.G.Corps) in Abuja today. Sign up for similar job alerts.
at the guardianai systemsarchitectcorps
https://jobs.orbit.mit.edu/companies/formlabs/jobs/44990107-optical-systems-architect
Optical Systems Architect @ Formlabs | MIT Job Board
Search job openings across the MIT network.
optical systemsjob boardarchitectformlabsmit
https://jobs.bilfinger.com/job/Mannheim-HCM-Systems-Architect-%28mwd%29-BW-68163/1277654901/
HCM Systems Architect (m/w/d) Stellendetails | Bilfinger
Mannheim HCM Systems Architect (m/w/d) - BW, 68163
systems architecthcmwbilfinger
https://featured.com/p/alex-mayhew
Alex Mayhew, Technical Advisor & Systems Architect, Founder - Mayhew Technology LLC | Featured
technical advisorsystems architectalexmayhewfounder
https://jobs.8vc.com/companies/joby-aviation/jobs/76926985-autonomy-systems-architect
Autonomy Systems Architect @ Joby Aviation | 8VC Job Board
Search job openings across the 8VC network.
autonomy systemsjoby aviationarchitectboard
https://careers.georgian.io/companies/cyera-2/jobs/59375322-senior-customer-success-systems-architect
Senior Customer Success Systems Architect @ Cyera | Georgian Job Board
Search job openings across the Georgian network.
customer successsystems architectjob boardseniorcyera
https://jobs.eniac.vc/companies/xwing/jobs/76625283-autonomy-systems-architect
Autonomy Systems Architect @ XWING | Eniac Ventures Job Board
Search job openings across the Eniac Ventures network.
autonomy systemsjob boardarchitectxwingeniac
https://hugeshout.in/2022/03/01/systems-architect-xdomain-entry-platform-job-vacancy-in-continental-ag-bengaluru-karnataka-updated-today/
Systems Architect (xDomain Entry Platform) Job Vacancy in Continental AG Bengaluru, Karnataka -...
Mar 1, 2022 - Are you looking for a New Job or Looking for better opportunities? We got a New Job Opening for Full Details : Company Name : Continental AG Location :...
systems architectjob vacancycontinental agentryplatform
https://careers.rtx.com/global/en/job/01839435/Associate-Director-Proprietary-Platforms-Systems-Architect-Onsite
Associate Director - Proprietary Platforms Systems Architect (Onsite) in sterling, Virginia, United...
Apply for Associate Director - Proprietary Platforms Systems Architect (Onsite) job with RTX in sterling, Virginia, United States of America. Engineering at RTX
associate directorsystems architectproprietaryplatformsonsite
https://shecancode.io/job/lead-principal-software-engineer-systems-architect/
Lead Principal Software Engineer/Systems Architect - SheCanCode
Apr 21, 2026 - Apply for this Lead Principal Software Engineer/Systems Architect role here and find out more about working at Soundcloud.
principal software engineersystems architectleadshecancode
https://www.ajabrown.com/
Aja Brown | Solutions + Systems Architect
Aja Brown is a growth expert and solutions + systems architect specializing in public sector innovation, place-based development, and community transformation,...
systems architectajabrownsolutions
https://www.careerexplorer.com/careers/systems-architect/education-and-training-requirements/
Education and Training Requirements for a systems architect - CareerExplorer
Becoming a systems architect involves several key steps. Here's a general roadmap to help you become a systems architect:
education and trainingsystems architectrequirementscareerexplorer
https://www.builtinboston.com/job/senior-network-systems-architect/8681530
Senior Network Systems Architect - Ultragenyx | Built In Boston
Ultragenyx is hiring for a Senior Network Systems Architect in Bedford, MA, USA. Find more details about the job and how to apply at Built In Boston.
built in bostonsenior networksystems architect
https://allanjude.com/
Allan Jude | Storage & Systems Architect
allan judestorage systemsarchitect
https://app.welcometothejungle.com/jobs/oYezDB6H
GlossGenius Senior Copywriter & AI Systems Architect | Welcome to the Jungle (formerly Otta)
Only matches tailored to your preferences. Only the most exciting, innovative and fast-moving companies.
senior copywriterai systemswelcome tothe junglearchitect
https://jobs.silkroad.com/Core4ce/Careers/Apply/MultiForm/1202?index=0
Apply to Systems Architect - Springfield, VA - Core4ce Careers - page 1
Find a career with Core4ce Careers
systems architectspringfield vacareers pageapply
https://shozab.com/
Shozab Hasan | Founder & Systems Architect
Shozab Hasan is the Founder of Regex Dot Pvt Limited, building reliable EdTech infrastructure with SCORM systems, learning data reliability, and scalable...
systems architecthasanfounder
https://www.techtarget.com/contributor/Stephen-Engelhardt
Stephen Engelhardt - St. Charles County Government, St. Charles, Mo., Systems Architect
Stephen Engelhardt is a systems architect for St. Charles County, Mo. During his 25 years in IT, he's held positions ranging from storage engineer to cloud...
st charles countysystems architectstephengovernmentmo
https://careers.adobe.com/us/en/job/R158280/Sr-AI-Systems-Architect-AI-ML-Brand-Concierge
Sr. AI Systems Architect (AI/ML), Brand Concierge in San Jose, California, United States of America...
Apply for Sr. AI Systems Architect (AI/ML), Brand Concierge job with Adobe in San Jose, California, United States of America. Engineering and Product at Adobe
ai systemssan joseunited statesof americasr
https://cgo.corporategray.com/jobs/systems-architect-staff-jobs-in-fort-worth-tx/
Systems architect staff jobs in Fort Worth, TX | Corporate Gray Online
10 systems architect staff jobs available in Fort Worth, TX on Corporate Gray Online. Apply or sign up for job alerts to get new jobs by email.
fort worth txsystems architectstaff jobscorporategray
https://www.victorbenazzi.com.br/
Victor Benazzi: AI & Automation Engineer | Growth Systems Architect
ai automation engineersystems architectvictorgrowth
https://careers.techtitans.org/companies/wells-fargo/jobs/76838392-lead-systems-architect-saas-cloud-security
Lead Systems Architect - SaaS & Cloud Security @ Wells Fargo | Tech Titans Job Board
Search job openings across the Tech Titans network.
lead systemscloud securitywells fargotech titansjob board
https://jobs.energyimpactpartners.com/companies/heron-power-2/jobs/55468339-principal-software-architect-energy-systems
Principal Software Architect, Energy Systems @ Heron Power | Energy Impact Partners Job Board
Search job openings across the Energy Impact Partners network.
software architectenergy systemsimpact partnersjob boardprincipal
https://biohired.com/jobs/142216
Process Architect at Veeva Systems in Massachusetts - Boston | Biohired
veeva systemsin massachusettsprocessarchitectboston
https://www.unjobnet.org/jobs/detail/86062788
UNJSPF INFORMATION SYSTEMS OFFICER (PLATFORM SOLUTION ARCHITECT)
Org. Setting and ReportingThe United Nations Joint Staff Pension Fund (UNJSPF) was established in 1949 by the United Nations General Assembly to provide...
information systemsplatform solutionunjspfofficerarchitect