Robuta

https://fairygodboss.com/jobs/northropgrumman/engineer-principal-engineer-systems-architect-8b08ed10c5946ec569f4a8878a7d6af8 Engineer / Principal Engineer Systems Architect at Northrop Grumman in Melbourne, FL | Fairygodboss Northrop Grumman is actively hiring a Engineer / Principal Engineer Systems Architect in Melbourne, FL . Find out more details about the job description and... systems architectnorthrop grummanmelbourne flengineerprincipal https://portfoliocareers.levelequity.com/companies/fivetran/jobs/69422265-sr-principal-ai-systems-architect Sr. Principal AI Systems Architect @ Fivetran | Level Equity Job Board Search job openings across the Level Equity network. ai systemsjob boardsrprincipalarchitect https://www.maksimmasalski.com/home Mr. Masalski | Physical AI & Edge Computing | RAG Systems Architect Bridging the gap between LLMs and local hardware. I create intelligent systems from architecting complex RAG pipelines to optimizing AI at the edge. ai edge computingrag systemsmrphysicalarchitect https://jobs.accel.com/companies/nimble-storage-2/jobs/74470838-channel-systems-architect-for-western-canada Channel Systems Architect for western Canada @ Nimble Storage | Accel Job Board Search job openings across the Accel network. channel systemswestern canadanimble storagejob boardarchitect https://recursiveintelligence.io/ Seth Robins | Industrial AI & Systems Architect Connecting practical AI and ML methodologies to the latest research. Combating cognitive atrophy and AI misuse with scientific skepticism and rigor. industrial aisystems architectsethrobins https://www.clearancejobs.com/jobs/8884752/systems-architect-senior Systems Architect (Senior) Remote / Telecommute Jobs - ClearanceJobs Systems Architect (Senior) requiring an active security clearance. Find other Peraton defense and intelligence career opportunities on ClearanceJobs.com systems architectseniorremotetelecommutejobs https://jobs.anitab.org/companies/wells-fargo/jobs/76838392-lead-systems-architect-saas-cloud-security Lead Systems Architect - SaaS & Cloud Security @ Wells Fargo | AnitaB.org Job Board Join the AnitaB.org Job Board and Talent Network to search for jobs, explore companies, and upload your resume to find opportunities tailored just for you! lead systemscloud securitywells fargojob boardarchitect https://hussainjatoi.com/ AI Automation Consultant & Systems Architect | Hussain Jatoi I build AI automation systems, SEO infrastructure, and digital workflows that run your business around the clock. One expert. Full accountability. No agency... ai automationsystems architectconsultanthussain https://www.avclub.com/in-silicon-valley-everyone-is-the-systems-architect-of-1798187865 In Silicon Valley, everyone is the systems architect of their own destruction In Silicon Valley, everyone is the systems architect of their own destruction silicon valleythe systemstheir owneveryonearchitect https://muldoon.design/ Kevin Muldoon | Design Systems Architect & Writer design systems architectkevinmuldoonwriter https://daniellee.co.uk/ Daniel Lee | Senior Marketing Leader & AI Systems Architect Apr 24, 2026 - 15 years driving digital transformation and revenue growth for global brands. From technical SEO to AI-powered marketing operations, I build the systems that daniel leemarketing leaderai systemsseniorarchitect https://iadsclick.com/ MarTech Revenue Growth Systems Architect | Advertising, Analytics Global AI & Infrastructure Global Revenue Systems Architect fixing broken attribution and building zero-leak data infrastructure. We provide AI implementation, MarTech RevOps, and... revenue growthsystems architectadvertising analyticsglobal aimartech https://jobs.hiringourheroes.org/jobs/467464570-f-35-systems-architect-senior-staff F-35 Systems Architect Senior Staff at Lockheed Martin - Hiring Our Heroes Job Board hiring our heroessystems architectsenior stafflockheed martinjob board https://www.linkedinliu.com/ Ziping Liu - Professional Portfolio Profile | LinkedIn | AI Systems Architect & Sole Creator of... Feb 28, 2026 - Ziping Liu is a US-based AI Architect and the sole engineer behind the GaiaGraph decision-intelligence platform. He independently developed the ARC/CRA... professional portfolioai systemsliuprofilelinkedin https://careers.thalesgroup.com/es/es/job/R0324935/Computer-Systems-Architect Electronic Countermeasures (ECM) Systems Architect in Crawley, Reino Unido | Sistemas at Thales... aplica trabaja con Thales Group in . enThales Group systems architectreino unidoelectroniccountermeasuresecm https://www.tonex.com/training-courses/certified-advanced-space-systems-architect-cassa/ Certified Advanced Space Systems Architect (CASSA) - Tonex Training Certified Advanced Space Systems Architect (CASSA) Certification Program by Tonex prepares experienced engineers and technical leaders to design and oversee... space systemstonex trainingcertifiedadvancedarchitect https://jobpromax.com/jobs/rf_systems_architect_control_algorithms_363022 RF Systems Architect - Control Algorithms at Apple | JobProMax | JobProMax rf systemsarchitectcontrolalgorithmsapple https://councils.forbes.com/profile/Malar-Mangai-Kondappan-Systems-Architect-/e0d4b08e-c9bc-4094-84be-a5085d954653 Malar Mangai Kondappan | Systems Architect - - | Forbes Technology Council Find articles by Malar Mangai Kondappan, Systems Architect of - and member of the Forbes Technology Council forbes technology councilsystems architect https://careers.redpoint.com/companies/psiquantum/jobs/73994843-principal-power-systems-architect-quantum-infrastructure Principal Power Systems Architect, Quantum Infrastructure @ PsiQuantum | Redpoint Ventures Job Board Search job openings across the Redpoint Ventures network. power systemsquantum infrastructureredpoint venturesjob boardprincipal https://www.dice.com/job-detail/98d5a344-71ec-4e5a-b9fe-c2058779099a Advisor Information Systems Architect - ServiceNow - Gainwell Technologies LLC - Austin, TX, US |... 30+ days ago - Be part of a team that unleashes the power of leading-edge technologies to help improve the health and well-being of those most vulnera... advisor informationsystems architectaustin txservicenowtechnologies https://blackfoals.com/ BLACKFOALS - IAKIES AKE - Alev Karatay | Epistemic AI Systems Architect IAKIES - I Alev Karatay Innovation Ecosystem ve AKE - Alev Karatay Epistemology. Epistemic AI Systems Architecture, AGI-oriented cognitive architecture,... ai systemsakealevkaratayepistemic https://hitmarker.net/jobs/unity-gtm-operations-and-ai-systems-architect-1703448 GTM Operations and AI Systems Architect - Unity | Hitmarker Unity is hiring a GTM Operations and AI Systems Architect. Apply now on Hitmarker. ai systemsgtmoperationsarchitectunity https://jobs.notablecap.com/companies/workstream-2/jobs/54773456-revenue-systems-architect Revenue Systems Architect @ Workstream | Notable Capital Job Board Search job openings across the Notable Capital network. systems architectnotable capitaljob boardrevenue https://workingreen.jobs/offers/cockpit-and-cabin-systems-architect-at-vertical-aerospace-bristol Cockpit and Cabin Systems Architect - Vertical Aerospace | Job at Vertical Aerospace - Cockpit and Cabin Systems Architect in Bristol, United Kingdom cabin systemsvertical aerospacecockpitarchitect https://www.virtusa.com/careers/au/sydney/others/pega-senior-systems-architect Pega Senior Systems Architect systems architectpegasenior https://jobs.unreasonablegroup.com/companies/sungreenh2/jobs/74076660-chipset-systems-architect Chipset Systems Architect @ SunGreenH2 | Unreasonable Job Board Search job openings across the Unreasonable network. systems architectjob boardchipsetunreasonable https://www.builtincolorado.com/job/senior-marketing-systems-architect/9249905 Senior Marketing Systems Architect - Huntress | Built In Colorado Huntress is hiring for a Remote Senior Marketing Systems Architect in United States of America. Find more details about the job and how to apply at Built In... built in coloradosystems architectseniormarketinghuntress https://www.softwaredevelopment.com.au/ Steve Goodwin | AI Systems Architect & Enterprise Architecture Consultant AI Systems Architect and Enterprise Architecture Consultant in Brisbane. Designing AI-enabled platforms, agent systems, software architecture, enterprise... ai systemsenterprise architecturestevegoodwinconsultant https://jobs.lenovo.com/zh_CN/careers/JobDetail/AI-Systems-Architect/74486 AI Systems Architect - - 74486 ai systemsarchitect https://www.elsejob.com/jobs/listing/systems-architect Systems Architect job vacancies | ElseJob Explore the freshest Systems Architect roles on ElseJob and post your company job listings for free. With ElseJob, connecting with top talent is effortless and... systems architectjob vacancies https://www.builtinsf.com/job/staff-storage-systems-architect/8846578 Staff Storage Systems Architect - Lambda | Built In San Francisco Lambda is hiring for a Staff Storage Systems Architect in San Francisco, CA, USA. Find more details about the job and how to apply at Built In San Francisco. in san franciscostorage systemsstaffarchitectlambda https://www.shine.com/job-search/systems-architect-jobs Systems Architect Jobs - 84,809 Systems Architect Job Vacancies in May 2026 Explore 84,809 Systems Architect jobs at Shine.com. Find your next role in building innovative applications. Browse Systems Architect openings and apply now to... systems architectjob vacanciesin mayjobs https://www.spacevibes.org/ SpaceVibes | Systems Architect and Deep Tech Holdings | Inc. Orbital IP and IP for 3D Live Streaming Teleport anywhere from a first person POV with SpaceVibes Inc. Become eye to eye with the Grand Sphinx, marvel at the textures of The Starry Night, learn... systems architectdeep techlive streamingholdingsinc https://www.interviews.chat/star-questions/it-systems-architect Behavioral Interview Questions for IT Systems Architect (STAR Method Answers) Explore the most common behavioral interview questions for IT Systems Architect with STAR Method answers to help you prepare and land the job. behavioral interviewfor itsystems architectstar methodquestions https://www4.lead411.com/Elizabeth_Albano_32650063.html Elizabeth Albano | Umpqua Bank | Email, IT Systems Architect Elizabeth Albanois the IT Systems Architect of . Lead411's profile includes an email address, umpquabank.com, linkedin, biography, etc umpqua bankit systemselizabethalbanoemail https://jobs.clevelandtalent.org/companies/heinen-s-grocery-store-2/jobs/76317246-systems-architect Systems Architect @ Heinen's Grocery Store | Destination Cleveland Job Board Search job openings across the Destination Cleveland network. systems architectgrocery storedestination clevelandjob boardheinen https://pitchmeai.com/jobs/firefly-aerospace/senior-spacecraft-power-systems-architect-r6ismyni3o Senior Spacecraft Power Systems Architect (Remote) at Firefly Aerospace | Apply at Firefly... Firefly Aerospace is hiring a Senior Spacecraft Power Systems Architect. Learn how to apply for this exciting remote role and email hiring manager at... power systemsfirefly aerospaceseniorspacecraftarchitect https://craigmbrown.com/ Craig Brown | AI Systems Architect Craig Brown - AI Systems Architect building multi-agent platforms, prediction markets, and privacy-first financial services for AI agents. craig brownsystems architect https://jobs.blockchaincapital.com/companies/ripple/jobs/76200602-gtm-systems-architect-ripple-treasury-ai-automation GTM Systems Architect, Ripple Treasury (AI & Automation) @ Ripple | Blockchain Capital Job Board Search job openings across the Blockchain Capital network. systems architectai automationblockchain capitaljob boardgtm https://www.hireitpeople.com/jobs/2874-virtual-systems-architect Virtual/Systems Architect - Hire IT People - We get IT done Short Description: Virtual/Systems Architect will be responsible for the assessment, design and build out of a new virtual and server infrastructure. The... virtual systemsarchitecthirepeopleget https://freel.ca/freelancer/matt-king Matt King - Senior Systems Architect | Ag Tech Developer | CAF Veteran | Freel matt kingsystems architectag techseniordeveloper https://neeraz.com/ Neeraz | Full-Stack Dev & Systems Architect Niraj Chandra Poudel (Neeraz). 10+ years of high-end web development and systems architecture. Based in Nepal, serving the world. full stack devsystems architect https://findzambiajobs.com/job/systems-architect-lumwana-mine/ Systems Architect - FZJ | Jobs in Zambia Apr 21, 2022 - Looking for the latest Systems Architect jobs in Zambia? Search and apply for suitable jobs in Zambia on Find Zambia Jobs. Zambia Jobs. systems architectjobs infzjzambia https://careers.qualcomm.com/careers/job/446715272067-systems-architect-sensors-technology-cork-ireland-cork-ireland?domain=qualcomm.com Systems Architect (Sensors Technology) (Onsite) - Cork, Ireland | Qualcomm BS Degree required, MS or PhD degree in related field highly desired SOC Architecture background with system design experience involving embedded software on a... systems architectsensorstechnologyonsitecork https://careers.franciscopartners.com/companies/forcepoint/jobs/76541605-it-systems-architect IT Systems Architect @ Forcepoint | Francisco Partners Job Board Search job openings across the Francisco Partners network. it systemsfrancisco partnersjob boardarchitectforcepoint https://www.themuse.com/jobs/apple/cellular-rf-systems-architect-92bba7 Cellular RF Systems Architect at Apple | The Muse | The Muse Find our Cellular RF Systems Architect job description for Apple located in Newton, MA, as well as other career opportunities that the company is hiring for. rf systemsthe musecellulararchitectapple https://jobs.nolavateblack.com/companies/apple/jobs/76664712-cellular-rf-receiver-systems-architect Cellular RF Receiver Systems Architect @ Apple | Nolavate Black Job Board Search job openings across the Nolavate Black network. systems architectjob boardcellularrfreceiver https://careers.bluewing.vc/companies/anduril/jobs/76915387-lead-electrical-systems-architect-edge-compute-and-communications Lead Electrical Systems Architect, Edge Compute and Communications @ Anduril | BlueWing Job Board Search job openings across the BlueWing network. electrical systemsedge computejob boardleadarchitect https://coloradospringschamberedc.com/find-a-job/job/software-systems-architect-with-clearance-2/ Software Systems Architect with Clearance - Colorado Springs Chamber & EDC software systemscolorado springsarchitectclearancechamber https://www.jobberman.com/listings/ai-systems-architect-technical-operator-d975qw AI Systems Architect at The Guardian Corps (T.G.Corps) | Jobberman Apply online for the ai systems architect vacancy at The Guardian Corps (T.G.Corps) in Abuja today. Sign up for similar job alerts. at the guardianai systemsarchitectcorps https://jobs.orbit.mit.edu/companies/formlabs/jobs/44990107-optical-systems-architect Optical Systems Architect @ Formlabs | MIT Job Board Search job openings across the MIT network. optical systemsjob boardarchitectformlabsmit https://jobs.bilfinger.com/job/Mannheim-HCM-Systems-Architect-%28mwd%29-BW-68163/1277654901/ HCM Systems Architect (m/w/d) Stellendetails | Bilfinger Mannheim HCM Systems Architect (m/w/d) - BW, 68163 systems architecthcmwbilfinger https://featured.com/p/alex-mayhew Alex Mayhew, Technical Advisor & Systems Architect, Founder - Mayhew Technology LLC | Featured technical advisorsystems architectalexmayhewfounder https://jobs.8vc.com/companies/joby-aviation/jobs/76926985-autonomy-systems-architect Autonomy Systems Architect @ Joby Aviation | 8VC Job Board Search job openings across the 8VC network. autonomy systemsjoby aviationarchitectboard https://careers.georgian.io/companies/cyera-2/jobs/59375322-senior-customer-success-systems-architect Senior Customer Success Systems Architect @ Cyera | Georgian Job Board Search job openings across the Georgian network. customer successsystems architectjob boardseniorcyera https://jobs.eniac.vc/companies/xwing/jobs/76625283-autonomy-systems-architect Autonomy Systems Architect @ XWING | Eniac Ventures Job Board Search job openings across the Eniac Ventures network. autonomy systemsjob boardarchitectxwingeniac https://hugeshout.in/2022/03/01/systems-architect-xdomain-entry-platform-job-vacancy-in-continental-ag-bengaluru-karnataka-updated-today/ Systems Architect (xDomain Entry Platform) Job Vacancy in Continental AG Bengaluru, Karnataka -... Mar 1, 2022 - Are you looking for a New Job or Looking for better opportunities? We got a New Job Opening for Full Details : Company Name : Continental AG Location :... systems architectjob vacancycontinental agentryplatform https://careers.rtx.com/global/en/job/01839435/Associate-Director-Proprietary-Platforms-Systems-Architect-Onsite Associate Director - Proprietary Platforms Systems Architect (Onsite) in sterling, Virginia, United... Apply for Associate Director - Proprietary Platforms Systems Architect (Onsite) job with RTX in sterling, Virginia, United States of America. Engineering at RTX associate directorsystems architectproprietaryplatformsonsite https://shecancode.io/job/lead-principal-software-engineer-systems-architect/ Lead Principal Software Engineer/Systems Architect - SheCanCode Apr 21, 2026 - Apply for this Lead Principal Software Engineer/Systems Architect role here and find out more about working at Soundcloud. principal software engineersystems architectleadshecancode https://www.ajabrown.com/ Aja Brown | Solutions + Systems Architect Aja Brown is a growth expert and solutions + systems architect specializing in public sector innovation, place-based development, and community transformation,... systems architectajabrownsolutions https://www.careerexplorer.com/careers/systems-architect/education-and-training-requirements/ Education and Training Requirements for a systems architect - CareerExplorer Becoming a systems architect involves several key steps. Here's a general roadmap to help you become a systems architect: education and trainingsystems architectrequirementscareerexplorer https://www.builtinboston.com/job/senior-network-systems-architect/8681530 Senior Network Systems Architect - Ultragenyx | Built In Boston Ultragenyx is hiring for a Senior Network Systems Architect in Bedford, MA, USA. Find more details about the job and how to apply at Built In Boston. built in bostonsenior networksystems architect https://allanjude.com/ Allan Jude | Storage & Systems Architect allan judestorage systemsarchitect https://app.welcometothejungle.com/jobs/oYezDB6H GlossGenius Senior Copywriter & AI Systems Architect | Welcome to the Jungle (formerly Otta) Only matches tailored to your preferences. Only the most exciting, innovative and fast-moving companies. senior copywriterai systemswelcome tothe junglearchitect https://jobs.silkroad.com/Core4ce/Careers/Apply/MultiForm/1202?index=0 Apply to Systems Architect - Springfield, VA - Core4ce Careers - page 1 Find a career with Core4ce Careers systems architectspringfield vacareers pageapply https://shozab.com/ Shozab Hasan | Founder & Systems Architect Shozab Hasan is the Founder of Regex Dot Pvt Limited, building reliable EdTech infrastructure with SCORM systems, learning data reliability, and scalable... systems architecthasanfounder https://www.techtarget.com/contributor/Stephen-Engelhardt Stephen Engelhardt - St. Charles County Government, St. Charles, Mo., Systems Architect Stephen Engelhardt is a systems architect for St. Charles County, Mo. During his 25 years in IT, he's held positions ranging from storage engineer to cloud... st charles countysystems architectstephengovernmentmo https://careers.adobe.com/us/en/job/R158280/Sr-AI-Systems-Architect-AI-ML-Brand-Concierge Sr. AI Systems Architect (AI/ML), Brand Concierge in San Jose, California, United States of America... Apply for Sr. AI Systems Architect (AI/ML), Brand Concierge job with Adobe in San Jose, California, United States of America. Engineering and Product at Adobe ai systemssan joseunited statesof americasr https://cgo.corporategray.com/jobs/systems-architect-staff-jobs-in-fort-worth-tx/ Systems architect staff jobs in Fort Worth, TX | Corporate Gray Online 10 systems architect staff jobs available in Fort Worth, TX on Corporate Gray Online. Apply or sign up for job alerts to get new jobs by email. fort worth txsystems architectstaff jobscorporategray https://www.victorbenazzi.com.br/ Victor Benazzi: AI & Automation Engineer | Growth Systems Architect ai automation engineersystems architectvictorgrowth https://careers.techtitans.org/companies/wells-fargo/jobs/76838392-lead-systems-architect-saas-cloud-security Lead Systems Architect - SaaS & Cloud Security @ Wells Fargo | Tech Titans Job Board Search job openings across the Tech Titans network. lead systemscloud securitywells fargotech titansjob board https://jobs.energyimpactpartners.com/companies/heron-power-2/jobs/55468339-principal-software-architect-energy-systems Principal Software Architect, Energy Systems @ Heron Power | Energy Impact Partners Job Board Search job openings across the Energy Impact Partners network. software architectenergy systemsimpact partnersjob boardprincipal https://biohired.com/jobs/142216 Process Architect at Veeva Systems in Massachusetts - Boston | Biohired veeva systemsin massachusettsprocessarchitectboston https://www.unjobnet.org/jobs/detail/86062788 UNJSPF INFORMATION SYSTEMS OFFICER (PLATFORM SOLUTION ARCHITECT) Org. Setting and ReportingThe United Nations Joint Staff Pension Fund (UNJSPF) was established in 1949 by the United Nations General Assembly to provide... information systemsplatform solutionunjspfofficerarchitect