https://www.asce.org/advocacy/policy-statements/ps549---unmanned-aircraft-systems
Use of UAS for civil engineering and other applications must be conducted under a regime that is safe and also compatible with standards and regulations.
unmanned aircraft systemspolicy statementasce
https://myadword.com/
At myadword.com, we believe in simplifying success. As a one-stop destination for businesses, we provide world-class solutions across multiple...
one stopbusiness elitehubsolutionspowered
https://www.bcorporation.net/en-us/programs-and-tools/policy-and-advocacy/
B Lab's global policy world advancing economic systems change around the world, including the Better Business Act in the UK, GITRE in Latin America, the...
b labglobal policyeconomic systemsadvancingchange
https://frac.org/blog/part-7-cutting-snap-how-harmful-policy-proposals-threaten-communities-and-rural-food-systems
Published May 8, 2025 Gina Plata-Nino, JD, Deputy Director of SNAP, FRAC, and John Benedict, CEO, farmer, and co-founder of The Local Co-op in rural Arizona....
policy proposalspartcuttingsnapharmful
https://insidegnss.com/?cat=1384,1371,1376,1369,1378,1375,1381,1382,1377,1383
Jun 9, 2023 - Global Navigation Satellite Systems Engineering, Policy, and Design
global navigationsatellite systemsgnssworldarchives
https://www.amazon.science/publications/policy-driven-neural-response-generation-for-knowledge-grounded-dialog-systems
Open-domain dialog systems aim to generate relevant, informative and engaging responses. In this paper, we propose using a dialog policy to plan the content...
policy drivendialog systemsneuralresponsegeneration
https://www.arvato-systems.com/privacy-policy
As a professional provider of IT solutions, the protection of your data is an important concern for us. Our goal is a transparent and legally compliant...
privacy policyarvato systems
https://jobs.visualnetsystems.com/cookies-policy/
Visual Net Systems (“us”, “we”, or “our”) uses cookies on website Visual Net Systems Jobs (the “Service”). By using the Service, you consent to the use of...
cookies policyvisualnetsystemsjobs
https://redmonk.com/jgovernor/sustainable-software-and-systems-efficiency-and-the-triple-win-policy-progress-and-modern-java-runtimes-like-quarkus/
The imperative for more sustainable and power efficient applications and systems is stronger than ever. Not only is the green agenda becoming more pressing,...
sustainable softwaresystemsefficiencytriplewin
https://www.fineos.com/resources/policy-administration-systems-fineos-aite-novarica-impact-report/
May 4, 2023 - Aite-Novarica report on solution providers in marketplace for policy administration systems (PAS) for life/annuity/benefits (L/A/B) insurers.
policy administrationaite novaricaimpact reportsystemsfineos
https://www.kcl.ac.uk/research/maps-research-group
The Maternal and Perinatal Systems and Policy (MAPS) Research Group assumes a life-course approach which is engaged with basic and clinical science research...
child healthsystems policymaternalresearchmaps
https://reliableembeddedsystems.com/privacy-policy/
Dec 28, 2022 - Reliable Embedded Systems – Privacy Policy Robert Berger – ReliableEmbedded Systems e.U. operates the www.ReliableEmbeddedSystems.com website,...
privacy policyembedded systemsreliable
https://naohealthobservatory.ca/grant-comparative-policy-research-projects/
Jun 13, 2024 - Academic research projects initiated by university-based researchers on various topics and questions of interest. All of these research projects involve health...
policy researchnorth americangrantampcomparative
https://www.nber.org/papers/w16453
Founded in 1920, the NBER is a private, non-profit, non-partisan organization dedicated to conducting economic research and to disseminating research findings...
policy optionsstate pensionsystemsimpact
https://www.ucpress.edu/books/systems-analysis-in-public-policy/paper
Scholarship is a powerful tool for changing how people think, plan, and govern. By giving voice to bright minds and bold ideas, we seek to foster understanding...
systems analysispublic policyidarhoos
https://reliefweb.int/report/world/global-food-policy-report-2024-food-systems-healthy-diets-and-nutrition
Analysis in English on World about Agriculture, Food and Nutrition and more; published on 29 May 2024 by CGIAR and IFPRI
global foodpolicy reporthealthy dietssystems
https://jobs.visualnetsystems.com/privacy-policy/
May 25, 2018 - Welcome, and thank you for your interest in jobs.visualnetsystems.com (“site”, “we” or “us”), and all related websites, downloadable software, mobile...
privacy policyvisualnetsystemsjobs
https://www.eco-business.com/zh-hans/press-releases/ethiopia-advances-youth-led-food-systems-transformation-through-new-science-policy-society-interface-workshop/
Ethiopia has taken an important step toward strengthening evidence-informed, inclusive, and youth-driven food systems transformation. With the workshop...
food systems transformationnew scienceethiopiaadvancesyouth
https://www.csulb.edu/academic-senate/policy-statement-10-09-engineering-systems-ba
Bachelor of Arts in Engineering Systems (code COE_BA01) (120 units) This new program was recommended by the Academic Senate on November 15, 2007, approved by...
policy statementengineering systemsacademic senateba
https://www.fao.org/food-systems/news/news-detail/towards-greater-policy-alignment--rwanda-s-food-systems-transformation-journey/en
As one of Africa’s most densely populated nations, Rwanda has made significant progress in reducing poverty and improving nutrition. However, challenges...
food systems transformationtowardsgreaterpolicyalignment
https://www.umassmed.edu/prc/ongoing-projects/built-environment--policy/
This pages describes research related to policies, systems, and the environment.
policysystemsenvironment
https://www.em-consulte.com/article/1775833/resume/bridging-health-and-global-climate-policy-opportun
Bridging health and global climate policy: Opportunities for policymakers and health systems
global climatebridginghealthpolicyopportunities
https://citizenlab.ca/2016/11/wechat-china-censorship-one-app-two-systems/
Nov 21, 2024 - In this report we provide the first systematic study of keyword and website censorship on WeChat, the most popular chat app in China
one apptwosystemswechatuses
https://www.fineos.com/blog/policy-administration-systems-empowering-business-goals/
Apr 6, 2023 - The importance of a modern purpose-built policy administration system for achieving business success and customer satisfaction. Contact FINEOS today.
policy administrationbusiness goalssystemsempowering
https://eos-aus.com/privacy-policy/
Nov 13, 2023 - By providing EOS with personal information persons agree to the use of personal information in accordance with this Privacy Policy.
privacy policyelectro opticsystems
https://www.cambridge.org/core/journals/environment-and-development-economics/article/abs/socialecological-systems-as-complex-adaptive-systems-modeling-and-policy-implications/C02DE8F7767B295C3289F51E83D845B4
Social-ecological systems as complex adaptive systems: modeling and policy implications - Volume 18 Issue 2
ecological systemssocialcomplexadaptivemodeling
https://www.sipri.org/commentary/topical-backgrounder/2025/dilemmas-policy-debate-autonomous-weapon-systems
Autonomous weapons systems raise profound questions about the human role in the use of force. How those questions get answered on the international stage, or...
autonomous weapon systemspolicy debatedilemmassipri
https://www.yorku.ca/dighr/events/systems-thinking-and-evidence-based-global-health-policy-challenges-and-opportunities-for-global-health-research-with-tarra-penney/?occurrence=2024-10-30&nskip=12691
Food insecurity, the emergence of zoonoses, anti-microbial resistance, and the related consequences of climate change are all major global health challenges,...
global health policysystems thinkingevidence basedchallenges