https://nolanlawson.com/about/
I’m Nolan Lawson, a programmer living in Seattle. Facts about me: works at Socket ex-Salesforce, ex-Microsoft, ex-Squarespace lived abroad in Ottawa and...
the teareadleaves
https://www.indiatimes.com/trending/social-relevance/men-try-to-fly-a-flying-bicycle-video-leaves-people-on-the-internet-shocked/articleshow/127155943.html
A group of men were seem trying something called 'Flying Bicycle' and it looks exactly like it sounds. Watch the viral video here.
to flymentryflyingbicycle
https://www.newschannel5.com/news/tarra-the-elephant-leaves-hohenwald-sanctuary-following-lengthy-legal-battle
The legal battle over custody of Tennessee's most famous elephant is over and Tarra is leaving the Elephant Sanctuary in Hohenwald.
the elephanttarraleaveshohenwaldsanctuary
https://metro.co.uk/2026/01/16/division-boss-leaves-ubisoft-work-eas-battlefield-26331029/
Jan 16, 2026 - Ubisoft veteran Julian Gerighty has revealed he's leaving The Division studio Massive Entertainment for a role at EA working on Battlefield.
the divisionto workbossleavesubisoft
https://pornsok.com/video/the-delivery-man-leaves-my-ass-with-a-lot-of-cum.html
Watch The Delivery Man Leaves my Ass with a Lot of Cum on FoxPorn, the best porn site. We have the biggest selection of amateur porn videos & missionary...
the delivery manmy asslot ofleaves
https://www.nwf.org/Magazines/National-Wildlife/2015/OctNov/Gardening/Leave-the-Leaves
Keeping fallen leaves on your property benefits benefits gardens and wildlife
you shouldthe leaves
https://www.atlanticcouncil.org/commentary/feature/the-legacy-brent-scowcroft-leaves-behind/
Scowcroft's death marks the loss of a foreign policy icon of historic accomplishment, unshakeable integrity, and consistency of purpose.
the legacybrent scowcroftatlantic councilleavesbehind
https://mygothgf.com/2024/11/01/black-maids-2-the-best-housework-is-the-kind-that-leaves-a-wet-spot-mygothgfcom
Regardez Black Maids #2 - The best housework is the kind that leaves... - Vidéo Blowjob sur MyGothGF. 79:35 de contenu de qualité.
black maidsthe besthouseworkkind
https://www.boredpanda.com/ending-relationship-bf-leaving-dog/?cexp_id=144328&cexp_var=9&_f=homepage_featured
Jan 16, 2026
the lineto workwomandrawsex
https://www.udiscovermusic.com/stories/nick-drake-five-leaves-left-album/
Sep 1, 2025 - The start of the all-too-brief recording life of Nick Drake, on his debut ‘Five Leaves Left,’ released by Island on September 1, 1969.
the legacyleavesnickalbumdebut
https://thewest.com.au/news/south-western-times/shortage-of-skilled-workers-leaves-builders-failing-to-meet-increasing-demand-for-housing-c-21524789
Builders across the region are facing difficulties meeting the high demand for housing with a shortage of skilled workers.
skilled workersshortageleavesbuildersfailing
https://golf.com/instruction/9-rules-every-golfer-know-dealing-with-leaves-course/
Know the rules and don't make a stupid mistake when the leaves start to drop in the rough or on the greens. Here's what you need to know.
ruleseverygolferneedsknow
https://elpasomatters.org/2025/04/22/patrick-crusius-criminal-case-ends-aug-3-walmart-mass-shooting/
Apr 23, 2025 - Over two days, 35 victims of the 2019 terror attack told the gunman and the world how their lives were forever altered.
mass shooterel pasothe lastwalmartleaves
https://dailycaller.com/2025/12/16/blood-bathtub-nick-michele-rob-reiner-murders-jail-suicide-watch/
Nick Reiner, arrested in connection with the murders of his parents, Rob and Michele Reiner, reportedly left behind a chilling trail of blood in a hotel.
suicide watchbloodybathtubrobmurder
https://metro.co.uk/2026/01/16/boy-3-leaves-grandma-blue-face-silly-prank-26329118/
Jan 16, 2026 - The incident happened at a family home in Criciuma, a city in the southern Brazilian state of Santa Catarina, where little Gabriel was lying in a hammock on...
in the faceboyleavesgrandmablue
https://www.thenationalnews.com/world/terror-attack-leaves-french-town-grappling-with-fear-and-hatred-1.97521
Many in France worry that attack will aggravate anti-Muslim sentiments coming so soon after the killings at satirical magazine Charlie Hebdo in Paris.
terror attackfrench townleavesgrapplingfear
https://www.tube8.com/porn-video/193554211/
Aug 2, 2025 - Watch the hot porn video I eat the milk of a fan and he leaves me well fucked for free. Tube8.com has the best hardcore Squirting movies and XXX videos that...
eat themilkfanleaves
https://www.japan.go.jp/kizuna/2023/10/sensing_japanese_autumn.html
Colored leaves vibrantly dye the Japanese autumn landscape, as seen at Chuson-ji temple, on the pilgrimage route in Shikoku, and in Shirakawa-go.
japanese autumnsensingamidcoloredleaves
https://www.espn.com/wwe/story/_/id/47363840/wwe-smackdown-takeaways-tag-team-title-match-leaves-desired
Dec 20, 2025 - A disappointing end to the men's tag team championship was emblematic of a building-block 'SmackDown.'
wwe smackdowntag teamtitle matchtakeawaysleaves
https://www.straitstimes.com/world/relatives-of-ecuador-inmates-clamour-for-news-after-bloody-riot
Six inmates were beheaded as rival gangs armed with guns and grenades went to war. Read more at straitstimes.com.
prison riotecuadordeploysthousandspolice
https://www.straitstimes.com/asia/se-asia/ferry-carrying-342-sinks-in-southern-philippines-at-least-8-dead-mayor
A ferry carrying 342 passengers sank in the southern Philippines, resulting in at least 8 confirmed casualties and ongoing rescue operations. Read more at...
southern philippinesferrysinkingkillsleaves
https://www.denver7.com/news/national/historic-strike-leaves-lasting-impact-on-universities-across-the-nation
Labor studies experts say universities are reflecting on their own pay and benefits to remain competitive
uc strikehistoricleaveslastingimpact
https://www.gettyimages.com/detail/news-photo/england-manager-roy-hodgson-looks-on-as-wayne-rooney-leaves-news-photo/541877892
England manager Roy Hodgson looks on as Wayne Rooney leaves the field following the UEFA Euro 2016 Group B match between Slovakia and England at Stade...
england managerroy hodgsonwayne rooneylooksleaves
https://www.jpost.com/international/article-882187
A Venezuelan academic said Maduro’s capture exposed a collapse of civilian authority, leaving a power vacuum filled by the military and external actors.
power vacuumacademicwarnsmadurocapture
https://www.military.com/undertheradar/2010/05/medal-of-honor-leaves-a-message
Electronic Arts really hits home with the trailers for its reboot of the Medal of Honor first-person shooter game.
medal of honorafter theleavesmessagetone
https://www.techradar.com/news/television/tv/sony-goes-all-out-for-mobile-and-leaves-tv-on-the-undercard-1123406
It's all about mobile and cameras for Sony this year
all outfor mobilesonygoesleaves
https://www.eporner.com/video-jDSMG1OjqUs/eng-sub-the-moment-her-husband-leaves-in-just-2-seconds-their-lips-and-body-overlap-mother-son-s-forbidden-urge-that-cannot-be-suppressed-momoko-isshiki/
Watch (Eng Sub) The Moment Her Husband Leaves, In Just 2 Seconds Their Lips And Body Overlap, Mother-Step Son's Forbidden Urge That Cannot Be Suppressed -...
eng subthe momenther husbandleaves
https://doezelf.nl/shop/lanarte-chatter-among-the-leaves-pn-0221128-borduren-pakket/
LanArte Chatter among the leaves PN-0221128 borduren (pakket) bij dé hobbywinkel in Schagen. Groot assortiment en scherpe prijzen. Veilig online en achteraf...
among the leaveschatterpn
https://mylust.com/videos/429584/this-exhibitionistic-granny-knows-the-best-way-to-remove-leaves-in-her-yard/
This old woman is hardly shy and she knows how to deal with leaves the sexiest way possible. She loves doing it naked and if you have a thing for older women...
the bestexhibitionisticgrannyknowsway
https://www.tribuneindia.com/news/ludhiana/ludhiana-mcs-plan-for-commercial-tag-to-krishna-hospital-road-leaves-locals-fuming/
MC Commissioner Aaditya Dachalwal did not respond to messages.
ludhianamcplancommercialtag
https://www.themirror.com/sport/american-football/joe-buck-mnf-troy-aikman-1497536
Nov 11, 2025 - Joe Buck leaves Troy Aikman chuckling as 'Monday Night Football' sinks to 16-year low point as the Philadelphia Eagles battled the Green Bay Packers...
joe bucktroy aikmanleavesmnfsinks
https://www.foxla.com/news/tesla-ceo-elon-musk-critical-of-california-leaves-the-state-and-moves-to-texas
Tesla CEO Elon Musk has left California and is now a resident of Texas.
elon muskthe stateteslaceocritical
https://nolanlawson.com/2017/03/05/what-it-feels-like-to-be-an-open-source-maintainer/
Outside your door stands a line of a few hundred people. They are patiently waiting for you to answer their questions, complaints, pull requests, and feature...
it feels liketo beopen sourcemaintainer
https://www.empflix.com/amateur-porn/my-parents-leaves-me-home-with-the-housekeeper/video3715969
Watch My parents Leaves Me Home With the Housekeeper. on EMPFlix free porn video on EMPFlix world`s best XXX HD porn tube site
with theparentsleaveshousekeeperempflix
https://nolanlawson.com/2024/12/30/2024-book-review/
2024 was another lite reading year for me. The fact that it was an election year probably didn’t help, and one of my resolutions for 2025 is to spend a...
book reviewthe teareadleaves
https://moms.red/v/hot-blonde-milf-wants-to-fuck-step-son-before-he-leaves.html
Free mom porn: Watch Hot Blonde MILF Wants to Fuck Step Son Before He Leaves video - the ultimate collection of free Xxx MILF and Xxx Xn HD porn. Watch best...
hot blonde milffuck step sonwatchwants
https://www.livescience.com/space/astronomy/space-photo-of-the-week-gods-hand-leaves-astronomers-scratching-their-heads
A new space photo captures "God's Hand", a cometary globule in the Gum Nebula, where stars are being born.
the weekspacephotogodhand
https://www.fieldgulls.com/seattle-seahawks-coaching-staff/159711/potential-klint-kubiak-replacement-options-if-he-leaves-seahawks-head-coach-nfl?utm_source=bleacherreport&utm_medium=referral
Jan 8, 2026 - With Klint Kubiak likely being one and done in Seattle, who could replace him?
klint kubiakpotentialreplacementoptionsleaves
https://creativecommons.org/2016/09/14/european-commission-copyright-proposal-leaves-users-dark/
Sep 27, 2023 - Copyright policy should benefit everyone, not just legacy rightsholders Today the European Commission released its legislative proposal for changes to EU...
in the darkeuropean commissioncopyrightproposalleaves
https://vitalentum.net/posts/298.html
NBA superstar LeBron James has the Lakers sweating after refusing to commit to a 22nd season with the team following their disappointing first-round playoff...
in the airlebron jamesleaveslakersfuture
https://www.koreatimes.co.kr/economy/20260114/money-leaves-banks-at-faster-pace-as-stock-market-rallies
Jan 14, 2026 - For Sung Moon-kyu, a salaried worker in Seoul, keeping money in the bank had long been the most reliable financial safety net as he was not adventu...
stock marketmoneyleavesbanksfaster
https://www.buzzfeed.com/mychalthompson/heated-rivalry-jordan-firstman-hudson-williams-feud-over
Dec 18, 2025 - "I Love LA" star, Jordan Firstman, was somewhat critical of his fellow HBO show, "Heated Rivalry," and fans aren't quick to forgive or...
heated rivalryfeudpossiblyendingleaves
https://www.umoartdesign.com/nl/the-lines-in-leaves-154253458.html
De fotografiekunst van Umo Art & Design blijft je aandacht trekken. De verlijming tussen plexiglas en dibond maakt de originele fotoafdrukken museumwaardig.
the linesleavesumoartamp
https://www.latimes.com/archives/la-xpm-1990-04-06-me-742-story.html
More than 14,000 customers in downtown Los Angeles were left without power Thursday afternoon when a Department of Water and Power station experienced an...
in the darkpower outagelos angelesleaveswide
https://www.investopedia.com/government-shutdown-leaves-fed-without-data-at-crucial-moment-11822415
The shutdown of the federal government will delay key reports on the job market and inflation, making it harder for officials to decide whether to cut interest...
government shutdownthe fedleaveswithoutdata
https://ltnpornlist.com/our-inexperienced-couples-stiff-fucky-fucky-in-from-the-rear-leaves-her-giant-fun-bags/
Our Inexperienced Couple's Stiff Fucky-fucky In From The Rear Leaves Her Giant Fun Bags
inexperiencedcouplestifffucky
https://milfsex.cc/cast/laura-bentley-drains-her-stepson-s-cock-when-hubby/
Watch mature video Laura Bentley Drains Her Stepson's Cock When Hubby Leaves The House from xxx categories: blonde, busty, creampie, doggystyle, petite, slim,...
laura bentleys cockwhen hubbydrainsstepson
https://theworld.org/stories/2016/07/30/mother-us-citizen-jailed-north-korea-leaves-pyongyang-without-son
The mother of Kenneth Bae, the US citizen and Christian missionary imprisoned in North Korea, ended her five-day visit saying she was 'more anxious than ever...
mother ofus citizennorth koreajailedleaves
https://hellporno.net/v/371640/
September 25, 2022 – Porn stars: Brenda, Pepiko. Tags: Amateur, Threesome, MMF, Mature, Mom, Sofa, Doggy style, Spread legs, Blowjob, Pussy licking, 1080p,...
nude maturethe stepsonhis bestmomleaves
https://pornbolt.com/video/64087/big-ass-nurse-fucks-her-patient-when-the-doctor-leaves-creampie-yasmina-khan
Watch Big Ass Nurse Fucks her Patient when the Doctor Leaves Creampie YASMINA KHAN For Free at Pornbolt.com, the best porn site. Pornbolt is home to the best...
big ass nursefucks herthe doctorpatientleaves
https://asiatimes.com/2026/01/us-debt-surge-leaves-china-japan-holding-the-bag-in-2026/
Jan 7, 2026 - TOKYO — A trillion here, a trillion there and pretty soon you’re talking about real money. This, with apologies to 1960s US Senator Everett Dirksen, is
holding the bagus debtchina japansurgeleaves
https://www.thetravel.com/the-faa-leaves-us-passengers-frustrated-over-its-air-traffic-controller-hiring-approach/
The FAA plans to hire nearly 9,000 air traffic controllers by 2028.
u sfaaleavespassengersfrustrated
https://www.thestar.com.my/business/business-news/2026/01/19/new-tech-leaves-other-sectors-behind
SHANGHAI: Nearly a year after DeepSeek's artificial intelligence (AI) breakthrough rattled global markets, China is entering 2026 with a fresh wave of...
behind the starnew techleavessectors
https://reedsy.com/discovery/book/leaves-on-the-loose-a-whirlwind-of-wonder-glenn-romans
Review: "Leaves on the Loose ~ A Whirlwind of Wonder" beautifully captured the splendor of fall (autumn). Pick up your copy today!
on the looseleaveswhirlwindwonderglenn
https://nolanlawson.com/2018/03/20/smaller-lodash-bundles-with-webpack-and-babel/
One of the benefits of working with smart people is that you can learn a lot from them through osmosis. As luck would have it, a recent move placed my office...
the teasmallerlodashbundleswebpack
https://landline.media/lawmakers-say-epa-reg-leaves-truckers-out-in-the-cold/
Nov 26, 2025 - Lawmakers have introduced a bill aimed at protecting truckers from an EPA regulation that causes diesel engines to shut down in cold weather.
out in thelawmakerssayepareg
https://theworld.org/stories/2016/07/30/london-bus-crash-leaves-dozens-injured
One of the city's iconic red double-decker buses crashes into a tree, injuring 32 people.
london busthe worldcrashleavesdozens
https://bleedingcool.com/comics/landry-walker-is-the-new-writer-on-red-lanterns-as-charles-soule-leaves-for-marvel/
Charles Soule is enjoying his Marvel exclusive contract now (even if not everyone at Marvel or DC knew when this actually happened) so he must bid one of
landry walkerthe newred lanternswriter
https://reddirtramblings.com/winter-walk/wheelbarrow-imp/
A wheelbarrow full of leaves for the compost pile sits at the edge of the garden. The 'Sango-kaku' Japanese maple and leaves of glass add color to a brown...
full ofcompost pilewheelbarrowleavessits
https://www.mdpi.com/1420-3049/29/9/2024
Every late autumn, fluttering poplar leaves scatter throughout the campus and city streets. In this work, poplar leaves were used as the raw material, while...
resourceutilizationpoplarleavesadsorption
https://www.beinsports.com/en-us/soccer/srie-a/articles/total-uncertainty-neymar-leaves-his-future-in-the-hands-of-santos-fc-2025-12-04
While Neymar shines with a hat trick and brings Santos closer to safety, he fuels the mystery about whether he will play his last game with the club.
in thetotaluncertaintyneymarleaves
https://people.com/mom-shocked-when-her-ex-leaves-their-son-6-home-alone-for-the-first-time-11877364
A mom is shocked when her ex leaves their son, 6, home alone for the first time. Now she doesn't know how to approach the topic with him.
mom shockedtheir sonexleaves
https://www.inverse.com/entertainment/scifi-movies-leaving-hbo-max-august-2021-prometheus
In 2011, Ridley Scott gave us an 'Alien' prequel that wasn't really a prequel. Here's why 'Prometheus' deserves another look on HBO Max.
need towatch thesci fiunderratedprequel
https://fappening.site/joy-corrigan-leaves-the-gym-in-a-tight-brown-outfit-in-nyc/
Sep 15, 2022 - American top model Joy Corrigan in spotted leaving the gym in NYC, 09/14/2022. Joy wore a tight brown outfit showing off her abs and model figure. The previous...
joy corriganthe gymleavestightbrown
https://www.inverse.com/entertainment/the-one-superhero-movie-you-need-to-watch-before-it-leaves-netflix-in-march
Netflix used to be the best place to watch recent Marvel movies, but with the launch of Disney+ that's no longer the case. The Marvel Cinematic Universe has a...
the onesuperhero movieneed towatch
https://www.wnycstudios.org/podcasts/takeaway/segments/electoral-stalemate-leaves-israels-political-future-question
Neither Prime Minister Benjamin Netanyahu or challenger Benny Gantz have enough votes to form a government.
electoralstalemateleavesisraelpolitical
https://thepornator.com/en/aiporn/content/2720465.html
Porn image A monokini that leaves very little to the imagination generated by AI. Original nude anime female character.
monokinileaveslittleimaginationfree
https://techcrunch.com/2018/03/28/solomon-hykes-leaves-docker-the-company-he-founded/
Mar 28, 2018 - Docker founder Solomon Hykes today announced that he is leaving the company he started. Docker, the open source project and eponymous company that
solomon hykesthe companyleavesdockerfounded
https://pubmed.ncbi.nlm.nih.gov/30890127/
The enzyme activities displayed might be associated with the bioactive compounds present in the extract which could possibly explain its use in the management...
ocimum gratissimumthe keylinnleavesreduce
https://www.hunker.com/2028442/why-orchid-leaves-droopy-should-i-cut-off/
Nov 22, 2025 - If your orchid's leaves are droopy, the plant may be overhydrated or dehydrated. You'll need to either trim the roots or give the orchid a soak to fix this.
the reasonorchiddroopyleavesbest
https://www.thenationalnews.com/sport/football/diego-maradona-s-death-leaves-a-nation-in-mourning-as-thousands-flood-the-streets-in-pictures-1.1118049
Three days of mourning declared for Argentina's favourite son
diego maradonain mourningdeathleavesnation
https://www.straitstimes.com/asia/se-asia/liu-xia-wife-of-late-dissident-liu-xiaobo-leaves-china-for-germany-friend-says
BEIJING (REUTERS) - Liu Xia, the widow of Chinese Nobel Peace Prize-winning political dissident Liu Xiaobo, arrived in Berlin on Tuesday (July 10), in news...
liu xiawifelatedissidentxiaobo
https://www.indiatimes.com/trending/social-relevance/this-is-the-beginning-of-the-end-ai-robots-romantic-conversation-leaves-internet-stunned/articleshow/122659111.html
A viral YouTube video featuring AI robots Ameca and Azi on a playful "cybernetic date" has amused internet users. Ameca, the "world's most advanced...
this isthe beginningendairobots
https://www.slashfilm.com/535821/darabont-wont-direct-the-huntsman/
We hope you weren't too excited about the idea of Frank Darabont directing the Snow White and the Huntsman prequel, because that is no longer happening. The...
frank darabontsnow whitethe huntsmanleavesprequel
https://hotntubes.com/to/3789842-mischievous_damsel_when_she_leaves_college_always_stops_by_the_crowns_palace_she_wants_to_penetrate_mischievous_damsel.html
mischievousdamselleavescollegealways
https://got2pee.com/videos/video-crouched/
A gorgeous brunette in a summer dress walks along a path and lifts up her dress, to spray her golden piss all over the ground, and keeps a lookout as it...
on the groundbrunetteleavestrailpiss
https://indianexpress.com/article/world/shooting-in-australian-town-leaves-3-dead-and-1-wounded-10488471/
Three people were killed and another injured after a shooting in the small New South Wales town of Lake Cargelligo.
shootingaustraliantownleavesdead
https://www.shemale-leaks.com/6796-i-just-love-how-pretty-the-leaves-are-this-time-of-year-.html
I just love how pretty the leaves are this time of year . Isnt it such a pretty time of the year for lil dresses . I’d love to be there for you to get a...
i justthe leavesthis timelovepretty
https://hyperallergic.com/the-surprising-beauty-of-dead-leaves-and-rotting-fruit/
There's something to be said for an impeccable still life, a carefully composed scene of blooming flowers and ripe, luscious food. But there's a reason that...
dead leavessurprisingbeautyrottingfruit