https://www.pxnventures.co.uk/
PXN Ventures | Venture Capital & Investment for the North
Nov 24, 2025 - PXN Ventures is the leading venture capital firm for the North of England, Scotland, and NI. We provide "more than money" support to high-growth founders.
ventures venture capitalpxninvestmentnorth
https://www.goldengate.vc/
Golden Gate Ventures | Venture Capital for Southeast Asia
Golden Gate Ventures is a global, early-stage venture capital firm that empowers audacious founders across 3 continents. Founded in 2011, Golden Gate Ventures...
ventures venture capitalgolden gatesoutheastasia
https://goalventurepartners.com/
Goal Ventures | Venture Capital for Games and Digital Media
ventures venture capitalgoalgamesdigitalmedia
https://www.rachelzoeventures.com/
Rachel Zoe Ventures | Venture Capital | West Hollywood
Rachel Zoe Ventures is an early stage venture capital firm focused on disruptive consumer technology platforms and solutions.
ventures venture capitalrachel zoewesthollywood
https://venturecapitalcareers.com/companies/cvx-ventures
CVX Ventures | Venture Capital Careers
CVX is one of Europe's fastest growing venture investors and is executing on our path to become Europe’s largest venture investor by providing high growth...
ventures venture capitalcvxcareers
https://adirvc.com/
Adir Ventures - Venture Capital, Private Equity, Seed Investing
Venture capital, Private Equity, and Seed Investing.
ventures venture capitalprivate equityadirseedinvesting
https://www.lumiraventures.com/login/
Login - Lumira Ventures | Venture Capital Life Sciences | Canada
lumira ventures venturecapital life sciencescanada
https://www.magmatic.ventures/index.html
MAGMATIC VENTURES - Venture Capital für Start-ups
Magmatic Ventures bietet Venture Capital Finanzierung für Start-ups und unterstützt Gründer mit Netzwerk und Know-how.
ventures venture capitalstartups
https://mobilityventures.com/
Mobility Ventures | Venture Capital for Disruptive Technology Startups
ventures venture capitaldisruptive technologymobilitystartups
https://www.lumiraventures.com/fr-ca/home-francais/
Home - Français - Lumira Ventures | Venture Capital Life Sciences | Canada
lumira ventures venturecapital life sciencescanada
https://www.lumiraventures.com/privacy-policy/
Privacy Policy - Lumira Ventures | Venture Capital Life Sciences | Canada
Mar 12, 2024 - Last Updated: 12th March, 2024 We respect the privacy of every individual who visits our Site. We will only collect Personal Information that is voluntarily...
lumira ventures venturecapital life sciencesprivacy policycanada
https://www.soundventures.com/
Sound Ventures | Venture Capital Firm
Sound Ventures | We invest early, move with conviction, and stay hands-on, supporting visionary founders as they scale what’s next. | Beverly Hills, CA
ventures venture capitalsoundfirm
https://www.synventures.com/
SYN Ventures | Venture Capital for Cybersecurity Innovators
Venture Capital for Cybersecurity Companies. SYN Ventures invests in disruptive, transformational solutions that reduce technology risk.
ventures venture capitalsyncybersecurityinnovators
https://www.3igventures.com/
3ig Ventures | Venture Capital | New York
3ig Ventures is a venture capital fund focused on seed stage and early stage investments. Located in New York, NY.
ventures venture capitalnewyork
https://www.lumiraventures.com/accessibility-statement/
Accessibility Statement - Lumira Ventures | Venture Capital Life Sciences | Canada
Oct 11, 2024 - Your experience matters to Lumira Ventures. Should you have accessibility feedback, we encourage you to reach out to us by email. Please include...
lumira ventures venturecapital life sciencesaccessibility statementcanada
https://benhamouglobalventures.com/
Benhamou Global Ventures | Venture capital firm in Silicon Valley
Sep 18, 2025 - BGV Focuses on Enterprise 4.0 companies and cross-border innovation. We deploy our financial and human capital from seed stage to IPO.
ventures venture capitalglobalfirmsiliconvalley
https://sprint.vc/
Sprint Ventures - Venture Capital Australia Brisbane Sydney Melbourne -
Jun 5, 2025 - Early stage Venture Capital firm based in Brisbane that's investing in extraordinary Australian companies that are building a better future.
ventures venture capitalaustralia brisbanesprintsydneymelbourne
https://7pv.com/
7PV - Seven Pillar Ventures - Venture Capital Firm
Mar 24, 2026 - As a boutique venture capital firm, we specialize in providing strategic investments and invaluable guidance to early-stage startups with promising ideas and...
ventures venture capitalsevenpillarfirm
https://santaclaraventures.com/
Santa Clara Ventures - Venture Capital, Santa Clara University
Santa Clara Ventures - Venture Capital for Santa Clara University Founders
ventures venture capitalsanta clarauniversity
https://www.nextplayventures.com/
Next Play Ventures - Venture Capital Investment and Coaching
ventures venture capitalnext playinvestmentcoaching
https://www.cleverton.vc/
Home | Cleverton Ventures | Venture Capital | France, United Kingdom
Cleverton Ventures is a Venture Capital fund investing in early-stage FinTech, InsurTech, HealthTech and FoodTech startups in Europe, North America and Israel...
ventures venture capitalfranceunitedkingdom
https://www.lumiraventures.com/terms-of-use/
Terms of Use - Lumira Ventures | Venture Capital Life Sciences | Canada
Oct 11, 2024 - Last Updated: 12th March, 2024 Definitions “Site” means this URL “www.lumiraventures.com” and any replacement thereof for which Lumira provides Site Material;...
lumira ventures venturecapital life sciencestermsusecanada
https://www.magmatic.ventures/
MAGMATIC VENTURES - Venture Capital für Start-ups
Magmatic Ventures bietet Venture Capital Finanzierung für Start-ups und unterstützt Gründer mit Netzwerk und Know-how.
ventures venture capitalstartups
https://www.hb-ventures.net/
HB Ventures - Venture Capital Investor
May 19, 2026 - HB Venture is a Venture Capital Investor led by Successful Entrepreneurs, Operators and Bankers. We focus on investing in early and growth stage technology...
ventures venture capitalhbinvestor
https://www.blackmountainventures.com/
Black Mountain Ventures | Venture Capital | Early-Stage Startups
Black Mountain Ventures invest in and support startups transforming the future of industries with AI technology.
ventures venture capitalblack mountainearly stagestartups
https://octopusventures.com/
Octopus Ventures | Venture Capital
Mar 12, 2026 - We provide venture capital investment for the people, ideas and industries that will change the world. Learn about what we do and the kind of founders we back.
ventures ventureoctopuscapital
https://menlovc.com/
Menlo Ventures | Early-Stage Venture Capital Firm
Dec 9, 2025 - Menlo Ventures is an early-stage venture capital firm that invests across AI, consumer, enterprise, and healthcare technologies.
ventures early stagemenlocapitalfirm
https://www.av.vc/
Invest in Startups | Venture Capital Access for Individuals | Alumni Ventures - Alumni Ventures
Access curated startup investment opportunities and diversified venture capital exposure designed for accredited investors.
venture capitalinveststartupsaccessindividuals
https://cleanenergyventures.com/
Clean Energy Ventures | Climate Tech Venture Capital
Mar 18, 2026 - Clean Energy Ventures invests in scalable early-stage climate tech startups and clean energy technologies addressing global climate change.
climate tech ventureclean energyventurescapital
https://www.arboretumvc.com/
Midwest Healthcare Venture Capital Firm | Arboretum Ventures
Mar 31, 2026 - For over 20 years we have been a successful healthcare venture capital firm rooted in the Midwest. Check out our portfolio companies.
venture capital firmmidwesthealthcarearboretumventures
https://hashgraphvc.com/
Hashgraph Ventures | AI & Blockchain Venture Capital
ventures aihashgraphblockchaincapital
https://www.yamahamotor.vc/
Yamaha Motor Ventures | Global Venture Capital Firm in Silicon Valley
Yamaha Motor Ventures is investing in early stage startups that are changing the world of Mobility, AgTech, and HealthTech.
global venture capitalyamaha motorventuresfirmsilicon
https://industryventures.durkancloud.net/
Industry Ventures - Collaborative and Innovative Venture Capital Platform
Mar 3, 2025 - Industry Ventures has cultivated new segments of the venture capital market for over two decades using its complete lifecycle approach.
venture capitalindustryventurescollaborativeinnovative
https://altventures.ca/
ALT VENTURES – Canada's Top Pre-Seed Venture Capital Firm for Entrepreneurs & Communities
venture capital firmtop prealtventurescanada
https://www.fog.ventures/
FOG Ventures | Venture Capital
FOG connects founders with operator investors who deliver customers, talent, and strategic advisory. Over 3,000 introductions made to help startups scale.
ventures venturefogcapital
https://psymed.ventures/
PsyMed Ventures - Frontier Brain and Mental Health Venture Capital Fund
Mar 7, 2026 - We are a venture fund investing in frontier brain and mental health: neurotech, precision psychiatry, novel therapeutics, digital therapeutics, holistic...
mental healthventure capitalventuresfrontierbrain
https://venturecapitalcareers.com/companies/thomson-reuters-ventures/jobs/summer-analyst-corporate-venture-capital-fund-internship
Summer Analyst, Corporate Venture Capital Fund Internship at Thomson Reuters Ventures • New York,...
Thomson Reuters Ventures is hiring a Summer Analyst, Corporate Venture Capital Fund Internship in New York, United States - Apply now on Venture Capital...
corporate venture capitalthomson reuterssummeranalystfund
https://www.questventures.com/businesses/venture-capital/
Venture Capital - Quest Ventures
Aug 14, 2024 - Driving the digital economy across Asia. Quest Ventures back early-stage companies and is usually the catalyst they need to disrupt their industry.
venture capitalquestventures
https://www.baeventures.com/en/how-we-work/our-approach/
Our Approach - How We Work - BAE Ventures - Venture Capital
ventures ventureapproachworkbaecapital
https://www.kensho.vc/
Kensho Ventures | European Deep-Tech Venture Capital
European deep-tech VC. EUR 500K first checks, hands-on infrastructure from Day 1. Investing in robotics, cybersecurity, quantum, and industrial AI.
european deep techkenshoventurescapital
https://capitallab-ventures.com/
Capital Lab Ventures | Venture Capital
capitallabventures
https://www.graphitevc.com/philosophy/
Our focus in Canada's venture capital | Graphite Ventures
Oct 20, 2025 - We are specialists at seed stage growth, helping founders build capital-efficient businesses that scale. Learn why we are the most trusted seed vc in Canada
venture capitalfocuscanadagraphiteventures
https://menlovc.com/focus-areas/cybersecurity/
Menlo Ventures | Cybersecurity Venture Capital Firm
Feb 16, 2026 - Menlo Ventures, a leading cybersecurity venture capital firm, partners with early-stage startups developing innovative, AI-native security solutions.
menlo venturescybersecuritycapitalfirm
https://www.venturesplatform.com/stories/venture-capital-as-a-catalyst-driving-africas-transformation-through-investment-in-innovation
Ventures Platform | Venture Capital as a Catalyst: Driving Africa’s Transformation Through...
ventures platformcapitalcatalystdrivingtransformation
https://menlovc.com/focus-areas/infrastructure/
Menlo Ventures | Infrastructure Venture Capital Firm
Feb 16, 2026 - Menlo Ventures invests in the infrastructure that powers AI and the cloud. We provide capital, guidance, and expertise to help infrastructure startups achieve...
menlo venturesinfrastructurecapitalfirm
https://www.aiconicventures.com/
AI & Deep Tech Venture Capital | AICONIC VENTURES
Nov 10, 2025 - AICONIC VENTURES is an AI and deep tech venture capital firm investing in the latest tech innovations. Connect with us to scale your breakthrough idea.
ai deep techventure capitalventures
https://vcwire.tech/2026/04/23/pegasus-tech-ventures-and-japanet-extend-corporate-venture-capital-fund-to-us200m/
Pegasus Tech Ventures and Japanet Extend Corporate Venture Capital Fund to US$200M
Apr 23, 2026 - Pegasus Tech Ventures, a global venture capital firm focused on startup investments and corporate innovation, expanded its corporate venture capital (CVC) fund...
corporate venture capitaltech venturespegasusextendfund
https://www.tysonfoods.com/innovation/food-innovation/tyson-ventures
Tyson Ventures: Our Food Venture Capital Firm | Tyson Foods
Tyson Ventures is the venture capital firm of Tyson Foods changing the food industry through food technology, emerging sources of protein and sustainable...
venture capital firmtysonventuresfood
https://vesaliusventures.com/
A venture capital firm created for diversified investments | Vesalius Ventures
Vesalius Ventures is a venture capital firm dedicated to accelerating the future of medicine by becoming the premier conduit for enabling technologies that...
venture capital firmcreateddiversifiedinvestmentsvesalius
https://backswingventures.com/
Defense & National Security Venture Capital | Backswing Ventures
Mar 19, 2026 - An early-stage venture firm investing in defense and national security technologies, backing founders building mission-critical companies.
defense national securityventure capitalventures
https://sawariventures.com/
Sawari Ventures – Leading Venture Capital in Egypt
leading venturesawariventurescapitalegypt
https://lfxvp.com/
LFX Ventures - A global venture capital firm focused on investing in the future of supply chain and...
We focus on investing in cutting-edge technologies and disruptive business models in Manufacturing, Logistics, and Commerce Enablement that drive innovation in…
global venture capitalfirm focusedsupply chainlfxventures
https://www.stventureslab.com/
Stand Together Ventures Lab | Early Stage Venture Capital for Health Care Education and Economic...
Stand Together Ventures Lab backs early stage founders solving America’s most pressing challenges in health care education and economic mobility through...
early stage venturehealth care educationstand togetherventureslab
https://www.kansaltancy.com/
Kansaltancy Ventures | Your IB | Venture Capital/ Debt/ SME IPO
venture capitalventuresibdebtsme
https://www.nexitventures.com/
Nexit Ventures - Nordic and Transatlantic Venture Capital - Activist VC
Feb 26, 2026 - Venture Capital focused on digital disruption. Home bases in the Nordic countries and Silicon Valley. Investing in disruptive and scalable Nordic companies.
venture capitalnexitventuresnordictransatlantic
https://www.baeventures.com/en/events/
Events - BAE Ventures - Venture Capital
Our aim is to provide remarkable moments, small but powerful, that can bring inspiration, education, mind changing and innovation. BAE Ventures engages a great...
ventures ventureeventsbaecapital
https://theoryvc.com/
Theory Ventures — AI-Focused Venture Capital
ai focusedtheoryventurescapital
https://roundtableventure.com/
Roundtable Ventures | Operator-Led Venture Capital
Roundtable (RVC) is a Silicon Valley based Early-stage Venture Capital Firm. We back visionary founders in AI, DeepTech, and Healthcare. We are the most...
operator ledroundtableventurescapital
https://sentiero.vc/
Home - Texas based venture capital investor in AI - Sentiero Ventures
Mar 30, 2021 - Dallas-based venture capital fund that invests in early seed stage startups developing artificial intelligence-enabled SaaS.
texas basedventure capitalinvestoraisentiero
https://www.av.vc/portfolio
Venture Capital Portfolio Companies | Alumni Ventures - Alumni Ventures
Explore 1,600+ venture capital portfolio companies across AI, health, fintech, and frontier sectors.
capital portfolio companiesventurealumni
https://valoventures.org/
Valo Ventures · Venture capital for a brighter future
venture capitalvaloventuresbrighterfuture
https://curine.com/
Venture Capital Funding | Small Business Funding For Startup Company - Curine Ventures
venture capitalsmall businessstartup companyfundingventures
https://www.av.vc/av-funds
Venture Capital & Startup Investment Funds | Alumni Ventures - Alumni Ventures
Browse diversified venture capital and startup investment funds across high-growth sectors and strategies.
venture capitalstartup investmentfundsalumniventures
https://terracapventures.com/
Terracap Ventures: Leading Venture Capital Firm in Canada
Dec 1, 2024 - Terracap Ventures is a premier venture capital firm in Canada, driving innovation through investments in growth-stage companies. Funding opportunities and...
venture capital firmventuresleadingcanada
https://halogenvc.com/
Halogen Ventures - Early Stage Venture Capital Fund
Halogen Ventures is an early stage venture capital fund investing in consumer technology companies led by women and based in Los Angeles.
ventures early stagehalogencapitalfund
https://ti.vc/
Titanium Ventures | Data Science Based Venture Capital for Technology Startups
Apr 17, 2025 - Titanium Ventures is the results-oriented VC partner to the most promising technology startups. Accelerating extraordinary companies and fueling growth of...
data scienceventure capitaltitaniumventuresbased
https://www.lumiraventures.com/about/
About Lumira Ventures | Life Sciences Venture Capital Firm | Toronto, Canada
Jun 18, 2025 - Lumira Ventures is a leading Canadian life sciences venture capital firm, investing in biotech, medtech, and healthcare companies that are transforming global...
venture capital firmlumira ventureslife sciencestorontocanada
https://www.baeventures.com/en/about-us/who-we-are/
Who We Are - About Us - BAE Ventures - Venture Capital
ventures ventureusbaecapital
https://www.flyingfish.vc/
Flying Fish Ventures | Seattle & Greater PNW Venture Capital Firm
Investing in the transformative power of Artificial Intelligence and Machine Learning.
flying fishventure capitalventuresseattlegreater
https://www.ketchventures.com/
Ketch Ventures | Consumer Venture Capital | United States
Ketch Ventures is an investor and strategic partner to early stage, disruptive, consumer facing businesses.
venture capitalketchventuresconsumerunited
https://lombardstreet.vc/
Lombardstreet Ventures – Pre-Seed Venture Capital Firm | Pre-Seed and Seed Funding
venture capital firmpre seedventuresfunding
https://www.bing-ventures.com/touch
Bing Ventures: A Crypto and Web3-Focused Venture Capital Firm
Shaping a Fair and Exciting Decentralized Future | We back startups and entrepreneurs driving the next wave of Web 3.0 and blockchain innovations.
venture capitalbingventurescryptofocused