Robuta

https://www.pxnventures.co.uk/ PXN Ventures | Venture Capital & Investment for the North Nov 24, 2025 - PXN Ventures is the leading venture capital firm for the North of England, Scotland, and NI. We provide "more than money" support to high-growth founders. ventures venture capitalpxninvestmentnorth https://www.goldengate.vc/ Golden Gate Ventures | Venture Capital for Southeast Asia Golden Gate Ventures is a global, early-stage venture capital firm that empowers audacious founders across 3 continents. Founded in 2011, Golden Gate Ventures... ventures venture capitalgolden gatesoutheastasia https://goalventurepartners.com/ Goal Ventures | Venture Capital for Games and Digital Media ventures venture capitalgoalgamesdigitalmedia https://www.rachelzoeventures.com/ Rachel Zoe Ventures | Venture Capital | West Hollywood Rachel Zoe Ventures is an early stage venture capital firm focused on disruptive consumer technology platforms and solutions. ventures venture capitalrachel zoewesthollywood https://venturecapitalcareers.com/companies/cvx-ventures CVX Ventures | Venture Capital Careers CVX is one of Europe's fastest growing venture investors and is executing on our path to become Europe’s largest venture investor by providing high growth... ventures venture capitalcvxcareers https://adirvc.com/ Adir Ventures - Venture Capital, Private Equity, Seed Investing Venture capital, Private Equity, and Seed Investing. ventures venture capitalprivate equityadirseedinvesting https://www.lumiraventures.com/login/ Login - Lumira Ventures | Venture Capital Life Sciences | Canada lumira ventures venturecapital life sciencescanada https://www.magmatic.ventures/index.html MAGMATIC VENTURES - Venture Capital für Start-ups Magmatic Ventures bietet Venture Capital Finanzierung für Start-ups und unterstützt Gründer mit Netzwerk und Know-how. ventures venture capitalstartups https://mobilityventures.com/ Mobility Ventures | Venture Capital for Disruptive Technology Startups ventures venture capitaldisruptive technologymobilitystartups https://www.lumiraventures.com/fr-ca/home-francais/ Home - Français - Lumira Ventures | Venture Capital Life Sciences | Canada lumira ventures venturecapital life sciencescanada https://www.lumiraventures.com/privacy-policy/ Privacy Policy - Lumira Ventures | Venture Capital Life Sciences | Canada Mar 12, 2024 - Last Updated: 12th March, 2024 We respect the privacy of every individual who visits our Site. We will only collect Personal Information that is voluntarily... lumira ventures venturecapital life sciencesprivacy policycanada https://www.soundventures.com/ Sound Ventures | Venture Capital Firm Sound Ventures | We invest early, move with conviction, and stay hands-on, supporting visionary founders as they scale what’s next. | Beverly Hills, CA ventures venture capitalsoundfirm https://www.synventures.com/ SYN Ventures | Venture Capital for Cybersecurity Innovators Venture Capital for Cybersecurity Companies. SYN Ventures invests in disruptive, transformational solutions that reduce technology risk. ventures venture capitalsyncybersecurityinnovators https://www.3igventures.com/ 3ig Ventures | Venture Capital | New York 3ig Ventures is a venture capital fund focused on seed stage and early stage investments. Located in New York, NY. ventures venture capitalnewyork https://www.lumiraventures.com/accessibility-statement/ Accessibility Statement - Lumira Ventures | Venture Capital Life Sciences | Canada Oct 11, 2024 - Your experience matters to Lumira Ventures. Should you have accessibility feedback, we encourage you to reach out to us by email. Please include... lumira ventures venturecapital life sciencesaccessibility statementcanada https://benhamouglobalventures.com/ Benhamou Global Ventures | Venture capital firm in Silicon Valley Sep 18, 2025 - BGV Focuses on Enterprise 4.0 companies and cross-border innovation. We deploy our financial and human capital from seed stage to IPO. ventures venture capitalglobalfirmsiliconvalley https://sprint.vc/ Sprint Ventures - Venture Capital Australia Brisbane Sydney Melbourne - Jun 5, 2025 - Early stage Venture Capital firm based in Brisbane that's investing in extraordinary Australian companies that are building a better future. ventures venture capitalaustralia brisbanesprintsydneymelbourne https://7pv.com/ 7PV - Seven Pillar Ventures - Venture Capital Firm Mar 24, 2026 - As a boutique venture capital firm, we specialize in providing strategic investments and invaluable guidance to early-stage startups with promising ideas and... ventures venture capitalsevenpillarfirm https://santaclaraventures.com/ Santa Clara Ventures - Venture Capital, Santa Clara University Santa Clara Ventures - Venture Capital for Santa Clara University Founders ventures venture capitalsanta clarauniversity https://www.nextplayventures.com/ Next Play Ventures - Venture Capital Investment and Coaching ventures venture capitalnext playinvestmentcoaching https://www.cleverton.vc/ Home | Cleverton Ventures | Venture Capital | France, United Kingdom Cleverton Ventures is a Venture Capital fund investing in early-stage FinTech, InsurTech, HealthTech and FoodTech startups in Europe, North America and Israel... ventures venture capitalfranceunitedkingdom https://www.lumiraventures.com/terms-of-use/ Terms of Use - Lumira Ventures | Venture Capital Life Sciences | Canada Oct 11, 2024 - Last Updated: 12th March, 2024 Definitions “Site” means this URL “www.lumiraventures.com” and any replacement thereof for which Lumira provides Site Material;... lumira ventures venturecapital life sciencestermsusecanada https://www.magmatic.ventures/ MAGMATIC VENTURES - Venture Capital für Start-ups Magmatic Ventures bietet Venture Capital Finanzierung für Start-ups und unterstützt Gründer mit Netzwerk und Know-how. ventures venture capitalstartups https://www.hb-ventures.net/ HB Ventures - Venture Capital Investor May 19, 2026 - HB Venture is a Venture Capital Investor led by Successful Entrepreneurs, Operators and Bankers. We focus on investing in early and growth stage technology... ventures venture capitalhbinvestor https://www.blackmountainventures.com/ Black Mountain Ventures | Venture Capital | Early-Stage Startups Black Mountain Ventures invest in and support startups transforming the future of industries with AI technology. ventures venture capitalblack mountainearly stagestartups https://octopusventures.com/ Octopus Ventures | Venture Capital Mar 12, 2026 - We provide venture capital investment for the people, ideas and industries that will change the world. Learn about what we do and the kind of founders we back. ventures ventureoctopuscapital https://menlovc.com/ Menlo Ventures | Early-Stage Venture Capital Firm Dec 9, 2025 - Menlo Ventures is an early-stage venture capital firm that invests across AI, consumer, enterprise, and healthcare technologies. ventures early stagemenlocapitalfirm https://www.av.vc/ Invest in Startups | Venture Capital Access for Individuals | Alumni Ventures - Alumni Ventures Access curated startup investment opportunities and diversified venture capital exposure designed for accredited investors. venture capitalinveststartupsaccessindividuals https://cleanenergyventures.com/ Clean Energy Ventures | Climate Tech Venture Capital Mar 18, 2026 - Clean Energy Ventures invests in scalable early-stage climate tech startups and clean energy technologies addressing global climate change. climate tech ventureclean energyventurescapital https://www.arboretumvc.com/ Midwest Healthcare Venture Capital Firm | Arboretum Ventures Mar 31, 2026 - For over 20 years we have been a successful healthcare venture capital firm rooted in the Midwest. Check out our portfolio companies. venture capital firmmidwesthealthcarearboretumventures https://hashgraphvc.com/ Hashgraph Ventures | AI & Blockchain Venture Capital ventures aihashgraphblockchaincapital https://www.yamahamotor.vc/ Yamaha Motor Ventures | Global Venture Capital Firm in Silicon Valley Yamaha Motor Ventures is investing in early stage startups that are changing the world of Mobility, AgTech, and HealthTech. global venture capitalyamaha motorventuresfirmsilicon https://industryventures.durkancloud.net/ Industry Ventures - Collaborative and Innovative Venture Capital Platform Mar 3, 2025 - Industry Ventures has cultivated new segments of the venture capital market for over two decades using its complete lifecycle approach. venture capitalindustryventurescollaborativeinnovative https://altventures.ca/ ALT VENTURES – Canada's Top Pre-Seed Venture Capital Firm for Entrepreneurs & Communities venture capital firmtop prealtventurescanada https://www.fog.ventures/ FOG Ventures | Venture Capital FOG connects founders with operator investors who deliver customers, talent, and strategic advisory. Over 3,000 introductions made to help startups scale. ventures venturefogcapital https://psymed.ventures/ PsyMed Ventures - Frontier Brain and Mental Health Venture Capital Fund Mar 7, 2026 - We are a venture fund investing in frontier brain and mental health: neurotech, precision psychiatry, novel therapeutics, digital therapeutics, holistic... mental healthventure capitalventuresfrontierbrain https://venturecapitalcareers.com/companies/thomson-reuters-ventures/jobs/summer-analyst-corporate-venture-capital-fund-internship Summer Analyst, Corporate Venture Capital Fund Internship at Thomson Reuters Ventures • New York,... Thomson Reuters Ventures is hiring a Summer Analyst, Corporate Venture Capital Fund Internship in New York, United States - Apply now on Venture Capital... corporate venture capitalthomson reuterssummeranalystfund https://www.questventures.com/businesses/venture-capital/ Venture Capital - Quest Ventures Aug 14, 2024 - Driving the digital economy across Asia. Quest Ventures back early-stage companies and is usually the catalyst they need to disrupt their industry. venture capitalquestventures https://www.baeventures.com/en/how-we-work/our-approach/ Our Approach - How We Work - BAE Ventures - Venture Capital ventures ventureapproachworkbaecapital https://www.kensho.vc/ Kensho Ventures | European Deep-Tech Venture Capital European deep-tech VC. EUR 500K first checks, hands-on infrastructure from Day 1. Investing in robotics, cybersecurity, quantum, and industrial AI. european deep techkenshoventurescapital https://capitallab-ventures.com/ Capital Lab Ventures | Venture Capital capitallabventures https://www.graphitevc.com/philosophy/ Our focus in Canada's venture capital | Graphite Ventures Oct 20, 2025 - We are specialists at seed stage growth, helping founders build capital-efficient businesses that scale. Learn why we are the most trusted seed vc in Canada venture capitalfocuscanadagraphiteventures https://menlovc.com/focus-areas/cybersecurity/ Menlo Ventures | Cybersecurity Venture Capital Firm Feb 16, 2026 - Menlo Ventures, a leading cybersecurity venture capital firm, partners with early-stage startups developing innovative, AI-native security solutions. menlo venturescybersecuritycapitalfirm https://www.venturesplatform.com/stories/venture-capital-as-a-catalyst-driving-africas-transformation-through-investment-in-innovation Ventures Platform | Venture Capital as a Catalyst: Driving Africa’s Transformation Through... ventures platformcapitalcatalystdrivingtransformation https://menlovc.com/focus-areas/infrastructure/ Menlo Ventures | Infrastructure Venture Capital Firm Feb 16, 2026 - Menlo Ventures invests in the infrastructure that powers AI and the cloud. We provide capital, guidance, and expertise to help infrastructure startups achieve... menlo venturesinfrastructurecapitalfirm https://www.aiconicventures.com/ AI & Deep Tech Venture Capital | AICONIC VENTURES Nov 10, 2025 - AICONIC VENTURES is an AI and deep tech venture capital firm investing in the latest tech innovations. Connect with us to scale your breakthrough idea. ai deep techventure capitalventures https://vcwire.tech/2026/04/23/pegasus-tech-ventures-and-japanet-extend-corporate-venture-capital-fund-to-us200m/ Pegasus Tech Ventures and Japanet Extend Corporate Venture Capital Fund to US$200M Apr 23, 2026 - Pegasus Tech Ventures, a global venture capital firm focused on startup investments and corporate innovation, expanded its corporate venture capital (CVC) fund... corporate venture capitaltech venturespegasusextendfund https://www.tysonfoods.com/innovation/food-innovation/tyson-ventures Tyson Ventures: Our Food Venture Capital Firm | Tyson Foods Tyson Ventures is the venture capital firm of Tyson Foods changing the food industry through food technology, emerging sources of protein and sustainable... venture capital firmtysonventuresfood https://vesaliusventures.com/ A venture capital firm created for diversified investments | Vesalius Ventures Vesalius Ventures is a venture capital firm dedicated to accelerating the future of medicine by becoming the premier conduit for enabling technologies that... venture capital firmcreateddiversifiedinvestmentsvesalius https://backswingventures.com/ Defense & National Security Venture Capital | Backswing Ventures Mar 19, 2026 - An early-stage venture firm investing in defense and national security technologies, backing founders building mission-critical companies. defense national securityventure capitalventures https://sawariventures.com/ Sawari Ventures – Leading Venture Capital in Egypt leading venturesawariventurescapitalegypt https://lfxvp.com/ LFX Ventures - A global venture capital firm focused on investing in the future of supply chain and... We focus on investing in cutting-edge technologies and disruptive business models in Manufacturing, Logistics, and Commerce Enablement that drive innovation in… global venture capitalfirm focusedsupply chainlfxventures https://www.stventureslab.com/ Stand Together Ventures Lab | Early Stage Venture Capital for Health Care Education and Economic... Stand Together Ventures Lab backs early stage founders solving America’s most pressing challenges in health care education and economic mobility through... early stage venturehealth care educationstand togetherventureslab https://www.kansaltancy.com/ Kansaltancy Ventures | Your IB | Venture Capital/ Debt/ SME IPO venture capitalventuresibdebtsme https://www.nexitventures.com/ Nexit Ventures - Nordic and Transatlantic Venture Capital - Activist VC Feb 26, 2026 - Venture Capital focused on digital disruption. Home bases in the Nordic countries and Silicon Valley. Investing in disruptive and scalable Nordic companies. venture capitalnexitventuresnordictransatlantic https://www.baeventures.com/en/events/ Events - BAE Ventures - Venture Capital Our aim is to provide remarkable moments, small but powerful, that can bring inspiration, education, mind changing and innovation. BAE Ventures engages a great... ventures ventureeventsbaecapital https://theoryvc.com/ Theory Ventures — AI-Focused Venture Capital ai focusedtheoryventurescapital https://roundtableventure.com/ Roundtable Ventures | Operator-Led Venture Capital Roundtable (RVC) is a Silicon Valley based Early-stage Venture Capital Firm. We back visionary founders in AI, DeepTech, and Healthcare. We are the most... operator ledroundtableventurescapital https://sentiero.vc/ Home - Texas based venture capital investor in AI - Sentiero Ventures Mar 30, 2021 - Dallas-based venture capital fund that invests in early seed stage startups developing artificial intelligence-enabled SaaS. texas basedventure capitalinvestoraisentiero https://www.av.vc/portfolio Venture Capital Portfolio Companies | Alumni Ventures - Alumni Ventures Explore 1,600+ venture capital portfolio companies across AI, health, fintech, and frontier sectors. capital portfolio companiesventurealumni https://valoventures.org/ Valo Ventures · Venture capital for a brighter future venture capitalvaloventuresbrighterfuture https://curine.com/ Venture Capital Funding | Small Business Funding For Startup Company - Curine Ventures venture capitalsmall businessstartup companyfundingventures https://www.av.vc/av-funds Venture Capital & Startup Investment Funds | Alumni Ventures - Alumni Ventures Browse diversified venture capital and startup investment funds across high-growth sectors and strategies. venture capitalstartup investmentfundsalumniventures https://terracapventures.com/ Terracap Ventures: Leading Venture Capital Firm in Canada Dec 1, 2024 - Terracap Ventures is a premier venture capital firm in Canada, driving innovation through investments in growth-stage companies. Funding opportunities and... venture capital firmventuresleadingcanada https://halogenvc.com/ Halogen Ventures - Early Stage Venture Capital Fund Halogen Ventures is an early stage venture capital fund investing in consumer technology companies led by women and based in Los Angeles. ventures early stagehalogencapitalfund https://ti.vc/ Titanium Ventures | Data Science Based Venture Capital for Technology Startups Apr 17, 2025 - Titanium Ventures is the results-oriented VC partner to the most promising technology startups. Accelerating extraordinary companies and fueling growth of... data scienceventure capitaltitaniumventuresbased https://www.lumiraventures.com/about/ About Lumira Ventures | Life Sciences Venture Capital Firm | Toronto, Canada Jun 18, 2025 - Lumira Ventures is a leading Canadian life sciences venture capital firm, investing in biotech, medtech, and healthcare companies that are transforming global... venture capital firmlumira ventureslife sciencestorontocanada https://www.baeventures.com/en/about-us/who-we-are/ Who We Are - About Us - BAE Ventures - Venture Capital ventures ventureusbaecapital https://www.flyingfish.vc/ Flying Fish Ventures | Seattle & Greater PNW Venture Capital Firm Investing in the transformative power of Artificial Intelligence and Machine Learning. flying fishventure capitalventuresseattlegreater https://www.ketchventures.com/ Ketch Ventures | Consumer Venture Capital | United States Ketch Ventures is an investor and strategic partner to early stage, disruptive, consumer facing businesses. venture capitalketchventuresconsumerunited https://lombardstreet.vc/ Lombardstreet Ventures – Pre-Seed Venture Capital Firm | Pre-Seed and Seed Funding venture capital firmpre seedventuresfunding https://www.bing-ventures.com/touch Bing Ventures: A Crypto and Web3-Focused Venture Capital Firm Shaping a Fair and Exciting Decentralized Future | We back startups and entrepreneurs driving the next wave of Web 3.0 and blockchain innovations. venture capitalbingventurescryptofocused