https://vicetemple.com/
We have all the tools and toys you need to start a porn site. Check our adult hosting services and launch your naughty website today.
adult hostingeverythingneedvicetemple
https://www.reviews.io/company-reviews/store/vicetemple
Dec 16, 2025 - Vicetemple has collected 76 reviews with an average score of 4.78. There are 70 customers that ❤ Vicetemple, rating them as excellent.
vicetemplereviewsreadnetbuy
https://blog.vicetemple.com/can-you-download-pornhub-videos/
Jan 29, 2024 - Are you wondering if you can download Pornhub videos? This guide will explain it, and provide instructions on all you need to do.
download pornhubvideosvicetemple
https://vicetemple.com/adult-seo-services
Does your porn site have performance issues? No worries! We'll give it a helping hand and have it stand firm in no time. Satisfaction guaranteed!
adult seo servicesvicetemple
https://blog.vicetemple.com/top-pornstar-onlyfans-models/
Nov 12, 2025 - Seasoned, sultry, and unstoppable—these pornstars on OnlyFans bring you raw, unfiltered access to the legends of adult entertainment.
toppornstarsonlyfansvicetemple
https://blog.vicetemple.com/start-a-webcam-business/
Feb 10, 2025 - Want to start a webcam business? Learn the ins and outs of the industry here, and set yourself and your models up for success!
webcam businessstartvicetemple
https://blog.vicetemple.com/top-anal-onlyfans-models/
Nov 12, 2025 - Tight, daring, and totally unrestrained—these top anal OnlyFans models take backdoor play to the next level and leave fans wanting more.
anal onlyfanstopmodelsvicetemple
https://vicetemple.com/adult-domain
It's all in the name and a great adult domain will make you stand out. Just think of porn stars like Johnny Sins or Abella Danger — instantly recognizable.
adultdomainsvicetemple
https://vicetemple.com/testimonials?tag=videox
A customer is like a partner. Make sure they're satisfied and they'll keep coming for more. See what ours have to say about our relationship.
testimonialsvicetemple
https://vicetemple.com/adult-vps
Experience complete freedom and start building the next porn empire on your adult VPS. Enjoy your private little playground on Vicetemple.
adultvpsvicetemple
https://vicetemple.com/adult-wordpress-themes/modelx
Are you an adult model and want to create your own website? The ModelX package has everything you need to spice up your online presence.
wordpress themeadultvicetemple
https://blog.vicetemple.com/top-instagram-onlyfans-models/
Oct 13, 2025 - Spicy, stunning, and camera-ready—these Instagram OnlyFans models are the ultimate eye candy bringing uncensored thrills to your feed.
instagram onlyfanstopmodelsvicetemple
https://blog.vicetemple.com/top-blonde-onlyfans-models/
Sep 23, 2025 - From bombshell beauty to girl-next-door charm, these top blonde OnlyFans models are guaranteed to steal your gaze and keep it.
blonde onlyfanstopmodelsvicetemple
https://vicetemple.com/adult-wordpress-themes/teasex
Need a site to showcase your content, drive fans to your OnlyFans, and grow as an adult content creator? Get TeaseX, and receive free hosting and a domain!
wordpress themeadultvicetemple
https://blog.vicetemple.com/top-british-onlyfans-models/
Nov 21, 2025 - From fiery redheads to bold blondes, these top British OnlyFans models prove the UK is home to some of Europe’s most irresistible women.
british onlyfanstopmodelsvicetemple
https://vicetemple.com/charity-work
We support both giving and receiving; in this case, us giving money and charities receiving it. Part of our earnings always goes to those in need.
charity workvicetemple
https://blog.vicetemple.com/how-to-sell-homemade-porn/
Feb 10, 2025 - Today, anyone can make and sell homemade porn — and earn a killing in the process. Read our comprehensive guide, and see the money roll in.
homemade porncomplete guidesell
https://blog.vicetemple.com/top-lesbian-onlyfans-models/
Sep 13, 2025 - Sensual, wild, and unapologetically raw—these lesbian OnlyFans models bring you the ultimate girl-on-girl experience you can’t look away from.
lesbian onlyfanstopmodelsvicetemple
https://vicetemple.com/affiliate-program
Are you an adult industry veteran? Join our affilliate program and turn your website into a money-making machine.
affiliate programvicetemple
https://adultfucks.com/dating/vicetemple-hosting-the-ultimate-solution-for-adult-content-websites/
Jan 13, 2026 - Vicetemple started in 2016, but it's part of a larger group with years of experience hosting adult websites. Whether you run a blog, an online store
adult contentvicetemplehostingultimatesolution
https://vicetemple.com/domain-registration-agreement
A DRA is a binding agreement, which sounds much more fun than it is. Don't spend too much time on it — we're waiting on you.
domain registrationagreementvicetemple
https://vicetemple.com/refund-policy
At Vicetemple, we guarantee a happy ending. If you're not satisfied within 30 days, we'll refund all of your expenses.
refund policyvicetemple
https://vicetemple.com/adult-server
Make sure that your website is always up for action with our adult servers. You can start a new porn site or transfer your existing website today!
adultserversvicetemple
https://vicetemple.com/adult-ecommerce-design
Beauty may only be skin deep, but it turns heads and makes money. With Vicetemple designing your adult eCommerce site, you’ll be turning heads big and small.
ecommerce designadultvicetemple
https://blog.vicetemple.com/types-of-porn-sites/
Nov 20, 2024 - Are you confused by the many different types of porn sites on the net? Our in-depth guide will help you navigate that ever-changing landscape.
different typesporn sitesneedknow
https://vicetemple.com/prohibited-content-list
We're all for hardcore fun with you and your website, but even we have some boundaries. Cross them, and we're breaking up.
prohibitedcontentvicetemple
https://blog.vicetemple.com/sex-toy-business/
Feb 10, 2025 - Ever wondered how to start a sex toy business? Well, it’s time to stop wondering and start earning. Learn how to do that here.
online sexstarttoybusiness
https://blog.vicetemple.com/top-goth-onlyfans-models/
Nov 12, 2025 - Dark, sultry, and dripping with taboo allure—these top Goth OnlyFans models embody the ultimate blend of mystery, fetish, and temptation.
goth onlyfanstopmodelsvicetemple
https://blog.vicetemple.com/sell-feet-pictures/
Jan 29, 2024 - Are you flirting with the idea of selling feet pictures to make money online? Read our guide, snap those pics, and make a killing.
make moneysellfeetpicturesonline
https://blog.vicetemple.com/get-paid-to-watch-porn/
Feb 10, 2025 - Believe it or not, the perfect job actually does exist — and it’s getting paid to watch porn. Check our article if you’d like to learn more.
get paidwatch pornvicetemple
https://blog.vicetemple.com/start-a-dating-site/
Feb 10, 2025 - Interested in starting a dating site? We’ll teach you how to make a career out of bringing people together and sharing the love.
dating sitestartvicetemple
https://blog.vicetemple.com/what-is-onlyfans/
Feb 18, 2025 - What is OnlyFans? Discover how this platform works, what it offers, and how creators make money while fans get exclusive content.
onlyfansworkvicetemple
https://blog.vicetemple.com/how-to-start-a-porn-company/
Feb 10, 2025 - If you’re wondering how to start a porn company, this guide will answer your questions, and get you ready to make bank in the porn industry.
complete guidestartporncompany
https://blog.vicetemple.com/how-to-download-porn/
Feb 10, 2025 - Streaming may be the norm these days, but there’s still a lot to love about downloading porn. Read on to learn this lost art.
download pornvicetemple
https://blog.vicetemple.com/
The Vicetemple blog is the largest library of forbidden porn knowledge. Heed our sinful wisdom, and all your adult business ventures will be successful.
vicetemple
https://blog.vicetemple.com/sell-your-sex-tape/
Jul 12, 2023 - Filming yourself and your partner having sex is hot as well, but did you know that it can make you money? Learn how to sell your sex tape.
sex tapesellonlinevicetemple
https://pornwebmasters.com/2180/vicetemple
Vicetemple.com was built for adult site owners. They have dozens of plans that will suit any project big or small. Get started with a pla...
vicetemplecompornhostingsite
https://blog.vicetemple.com/adult-web-designer/
Feb 10, 2025 - Whether you’re looking to start an adult website or tune up an existing one, you won’t get far without a good designer. Here’s how to choose a great one.
web designerchooseadultvicetemple
https://vicetemple.com/contact-us
Does something tickle your fancy? You can ask us anything — and we do mean anything.
usvicetemple
https://blog.vicetemple.com/how-to-make-money-on-xvideos/
Feb 10, 2025 - Are you wondering how to make money on XVideos? Check our guide, join the thriving industry, and learn how to make big numbers with little effort.
make moneyxvideosvicetemple
https://vicetemple.com/adult-website-design
Our experts in adult web design will give your porn site the makeover it needs to turn heads all over the internet.
adult web designvicetemple
https://blog.vicetemple.com/how-to-start-a-porn-site/
Oct 14, 2025 - Porn is a $100 billion industry, and if you start a porn site in 2024, you’ll be able to grab a piece of those riches. Read our guide to learn how to do it.
porn sitestartstep
https://vicetemple.com/adult-web-development
Have a website idea that’s too big to fit into a template? Vicetemple will hear out your fantasies and build them from the ground up.
adult web developmentvicetemple
https://vicetemple.com/pornhub-clone-script
Pornhub earns almost a billion bucks per year, so they gotta be doing something right. With our Pornhub clone script, you too can get a piece of that pie.
pornhubclonescriptvicetemple
https://blog.vicetemple.com/top-onlyfans-babes/
Sep 4, 2025 - Craving fire? These scorching hot OnlyFans babes bring the heat straight to your screen—watch out, you just might get burned!
onlyfans babestopvicetemple
https://blog.vicetemple.com/how-to-make-money-on-pornhub/
Feb 10, 2025 - Are you a porn enthusiast? How about turning that passion into money — by making it on Pornhub? Check our guide for more information.
make moneypornhubvicetemple
https://vicetemple.com/testimonials
A customer is like a partner. Make sure they're satisfied and they'll keep coming for more. See what ours have to say about our relationship.
testimonialsvicetemple
https://vicetemple.com/redtube-clone-script
Want to launch a porn website right now? Our Redtube clone script will have your visitors blush with desire and your competition turn green with envy.
redtubeclonescriptvicetemple
https://vicetemple.com/xhamster-clone-script
Do you ever wish you had all of xHamster to yourself? Our clone script will make it happen, will little to no work on your part.
xhamsterclonescriptvicetemple
https://vicetemple.com/adult-web-hosting
Explore your naughty side and start a website with our adult web hosting plans. Every service comes with cPanel, a dedicated IP, and unlimited traffic.
web hostingadultvicetemple
https://blog.vicetemple.com/is-selling-feet-pictures-legal/
Apr 18, 2024 - Selling feet pics is one of the most lucrative side hustles in the adult industry. But is it legal? Here’s all you’ll need to know before you get started.
sellingfeetpictureslegalvicetemple
https://vicetemple.com/adult-wordpress-themes/pornx
Launch your porn site in one hour and start exploring your naughty side with the PornX WordPress theme.
wordpress themepornxadultvicetemple
https://pornguide.blog/useful-software/vicetemple/
Aug 30, 2022 - The adult industry is one of the most well-known and rapidly expanding businesses. The entire sector is booming, including porn websites, webcam chat rooms,...
vicetempleguide
https://vicetemple.com/testimonials?tag=dedicated_server
A customer is like a partner. Make sure they're satisfied and they'll keep coming for more. See what ours have to say about our relationship.
testimonialsvicetemple
https://vicetemple.com/about-us
Here we are, just the two of us, ready to share all about us and our deepest desires. We promise not to tell, but only if you don't!
usvicetemple
https://affninja.io/vicetemple-review/
Dec 15, 2025 - Is Vicetemple the king of adult hosting? Our Vicetemple review reveals the truth about their speed, offshore privacy, and ignored DMCA claims. Read now!
vicetemplereviewfastprivateamp
https://blog.vicetemple.com/best-porn-niches/
Feb 10, 2025 - Want to create a porn site but know next to nothing about porn niches? Read on, and we'll help you figure out the right one for you.
best pornnichesexplorevicetemple
https://blog.vicetemple.com/how-to-start-an-onlyfans/
Feb 10, 2025 - Are you wondering how to start an OnlyFans? Read our guide, and your admirers will be lining up to shower you with money and admiration.
startonlyfansvicetemple
https://blog.vicetemple.com/top-big-ass-onlyfans-models/
Nov 12, 2025 - Thick, juicy, and impossible to ignore—these top big ass OnlyFans models will have you mesmerized with every curve and bounce.
big ass onlyfanstopmodelsvicetemple
https://blog.vicetemple.com/best-adult-payment-processors/
Aug 14, 2023 - Do you need a reliable payment processor for your adult website? With these PayPal alternatives, your money will be in safe hands until it reaches you.
payment processorsbestadultamppaypal
https://vicetemple.com/xvideos-clone-script
Don't have time to fool around? Create a new — better XVideos, and launch your porn site with a bang!
xvideosclonescriptvicetemple
https://blog.vicetemple.com/what-is-a-webcam-model/
Sep 22, 2023 - Discover the world of webcam modeling and learn about the job’s requirements, its benefits and challenges, and how to get started.
webcam modelvicetemple
https://blog.vicetemple.com/weird-ways-to-make-money-on-onlyfans/
Mar 20, 2025 - OnlyFans creators are making bank in all sorts of ways, from unexpected to downright weird. Come and see what out-of-the-box thinking on the site looks like.
make moneyweirdwaysonlyfansvicetemple
https://vicetemple.com/adult-scripts
If you're not up for foreplay and just want to get down to business, our adult website scripts will scratch that itch right away. Start your porn site today!
adult websitescriptsvicetemple
https://blog.vicetemple.com/sell-nudes/
Feb 10, 2025 - Do you want to sell nudes online? We’ll teach you where and how to do it, and answer any other questions you may have about it.
sellnudesonlinevicetemple
https://blog.vicetemple.com/how-to-create-porn-with-ai/
Feb 7, 2025 - Are you looking for the best AI tools for crafting porn? We’ve got you covered—here are the best options for creating erotica, images, and videos.
createpornaivicetemple
https://vicetemple.com/terms-of-service
Everyone is welcome in our temple of vice, as long as they uphold our sacred Terms of Service. Break them, and you're no longer welcome.
termsservicevicetemple
https://blog.vicetemple.com/sell-fetish-photos/
Jul 12, 2023 - Selling fetish photos is an amazing way for a content creator to make money. If you’re interested, our guide will hit your sweet spot.
fetish photossellampvideosvicetemple
https://vicetemple.com/privacy-policy
Our lips are sealed, except when you don't want them to be. Our privacy policy makes sure of it.
privacy policyvicetemple
https://vicetemple.com/showcase
Want to start your very own adult website but aren't sure what to do? That's fine — here are some exceptional Vicetemple client websites that may inspire.
clientshowcasevicetemple
https://support.vicetemple.com/
Vicetemple's knowledge base contains everything you need to know to start your own adult website and take a bite out of that thriving industry.
knowledge basevicetemple