https://www.lanternwebservices.com/
Lantern Web Services | Web Design & Hosting Services | $49/Month
Sep 18, 2023 - We provide IP Phone/VoIP Services, Full Web Design, Email and hosting services. We do all the work so you can stay focused on your business. Whether you...
web services designlanternhostingmonth
https://www.winecountrywebservices.com/
Wine Country Web Services-Web Design, Web Hosting and Web Development
Wine Country Web Services is the top ranked web design, development and hosting firm in the Napa Valley. Rackspace hosting. Serving customers in the greater...
web services designwine countryhostingdevelopment
https://www.classicweb.com.ng/project/cutesmile-dental-clinic/
Cutesmile Dental Clinic – Classic Web Services | Web Design in Port Harcourt
May 2, 2023 - Cutesmile Dental Clinic; is a first-rate, fully equipped modern dental facility for the management of oral and maxillofacial diseases and general dental...
web services designdental cliniccutesmileclassicport
https://ivycat.com/
IvyCat Web Services - Web Design & WordPress
web services designivycatwordpress
https://www.losangeleswebservices.com/
Los Angeles Web Services - Web Design, SEO, hosting, online marketing
Mar 24, 2019 - Small Business Web Design and SEO. Our Professional Web Designers will build you a fast loading responsive design site optimized for strong Google rankings.
los angeles webdesign seo hostingservicesonlinemarketing
https://clarihon.co.uk/
Clarihon Web Services - web design, internet marketing and SEO to businesses in Cornwall & Devon
welcome to the Clarihon website, providers of quality professional web site design, website maintenance and white hat search engine optimisation techniques...
web services designinternet marketingseobusinessescornwall
https://www.classicweb.com.ng/contact-us/
Contact Us – Classic Web Services | Web Design in Port Harcourt
Sep 9, 2025 - Contact Address 12 Udom Street D/Line Port Harcourt- Nigeria | Call/WhatsApp 08033862769, 09078488284 | info@classicweb.com.ng | Connect us @classicwebng
web services designusclassicportharcourt
https://www.classicweb.com.ng/blog/
Blog – Classic Web Services | Web Design in Port Harcourt
web services designblogclassicportharcourt
https://www.classicweb.com.ng/search-engine-optimization-in-port-harcourt-nigeria/
Search Engine Optimization – Classic Web Services | Web Design in Port Harcourt
May 10, 2023 - Our SEO services are tailored to your specific needs, ensuring long-term visibility and increased organic traffic. Partner with us to unlock the full potential...
search engine optimizationweb services designclassicportharcourt
https://www.classicweb.com.ng/project/school-software-pro/
School Software Pro – Classic Web Services | Web Design in Port Harcourt
May 2, 2023 - School Software Pro is All-in-One school management software in Nigeria with Mobile App for Primary, Secondary, Colleges, Polytechnics and University with 57+...
web services designschool softwareproclassicport
https://www.classicweb.com.ng/web-development-port-harcourt-nigeria/
About Us – Classic Web Services | Web Design in Port Harcourt
Sep 9, 2025 - Our services include website design and development, e-commerce solutions, web hosting, search engine optimization and digital marketing.
web services designusclassicportharcourt
https://launchsite.co.uk/
Launch Site – Edinburgh Web Services :: Design, Development, WordPress Development & Hosting
web services designdevelopment wordpresslaunchsiteedinburgh
https://www.classicweb.com.ng/digital-marketing-in-port-harcourt-nigeria/
Digital Marketing – Classic Web Services | Web Design in Port Harcourt
May 10, 2023 - Our comprehensive digital marketing services encompass a range of platforms, including Facebook, Twitter, Instagram, Google, and WhatsApp. Call 8033862769
web services designdigital marketingclassicportharcourt
https://agentic-web-services.com/
Agentic Web Services | Web Design · Servers · AI Agents
Agentic Web Services — Web design from $500, server infrastructure, AWS security hardening, Hetzner bare metal, and AI agents. One team, end-to-end.
web services designagenticserversaiagents
https://www.directglobal.net/
Direct Global Web Services - Web design, web hosting, web everything!
web services designdirectglobalhostingeverything
https://msedp.com/
Web & IT Services | WordPress & Website Design | Tech Support
Sep 30, 2022 - MSEDP - The Power of Technology. Offering IT managed services, remote tech support, website design, development, and hosting services.
services wordpressdesign techwebsupport
https://upqode.com/web-design/
WordPress Web Design Services - Attractive and Converting Websites
Sep 9, 2022 - Our creative designers develop eye-catching WordPress Web Design sites tailored to your business' needs. Years of expertise in UI and UX design.
wordpress web designservicesattractiveconvertingwebsites
https://mta360.com/
Home Services SEO, HVAC Social Media Management, HVAC Marketing & HVAC Web Design | | MTA360®
Mar 19, 2026 - Contact MTA360®, your local HVAC PPC, HVAC SEO, and HVAC Marketing company!
social media managementmarketing web designservices seohvac
https://jlbworks.com/
Nashville Web Design & Marketing – Voted #1 Website Design Services
nashville web designmarketingvotedservices
https://www.sumydesigns.com/
Web Design Services | Sumy Designs, LLC | Websites & More
Apr 20, 2026 - Your website should work as hard as you do. Sumy Designs offers strategic web design services with 20 years of expertise. Get started today.
web design servicessumy designsllcwebsites
https://www.sayenkodesign.com/
Seattle Web Design Agency & WordPress Development Services
seattle web designagency wordpressdevelopmentservices
https://www.gozoek.com/
Zoek: #1 Wix Digital Marketing Agency, SEO, Web Design & Development Services - Zoek Marketing
Zoek is the #1 growth marketing agency offering small business website design, SEO, social media marketing, online marketing tools, and white label services....
digital marketing agencyseo web designzoekwixdevelopment
https://gaugedigitalmedia.com/
#1 Digital Marketing For Home Services | SEO, PPC, Web Design
Apr 17, 2026 - Grow your home service company with Gauge Digital. Stop buying shared leads. Have us build your exclusive lead machine. Contact us today!
services seo ppcdigital marketingwebdesign
https://www.indiainternets.com/
Website Designing & Web Development Company in Delhi, India, Web Design Services in Delhi, NCR
Website designing company in Delhi- IndiaInternets, a trusted web development company in Delhi, India, offers renewed web design services to elevate your...
web development companydelhi indiadesign servicesdesigningncr
https://www.patienthoney.com/
Elevate Your Online Presence With Patient Honey Web Design Services
Dec 24, 2023 - Welcome to Patient Honey, your trusted partner for custom website design. Discover tailored solutions to boost your brand's digital impact and create a lasting...
online presenceweb designelevatepatienthoney
https://thirteen05.com/
Web Design and Digital Marketing Services - thirteen05 creative
Jan 28, 2026 - thirteen05 creative is a full-service web design and digital marketing agency that builds world-class websites and delivers SEO results.
digital marketing servicesweb designcreative
https://www.webmasterserviceshawaii.com/
Webmaster Services Hawaii | Web Design, WordPress, SEO, Hosting
May 16, 2026 - Honolulu web design, WordPress development, SEO, and hosting from Webmaster Services Hawaii. Serving Hawaii businesses since 2010. Free consultation.
web design wordpresswebmaster serviceshawaiiseohosting
https://www.bluecorona.com/
#1 Home Services Marketing Agency | SEO, PPC, Web Design
Oct 15, 2024 - Grow your business with Blue Corona, a home services marketing agency dedicated to growing the trades. Schedule a free marketing consultation today!
services marketing agencyseo ppc webdesign
https://mainehost.com/
Maine WordPress Hosting, Web Design & SEO Services
May 15, 2026 - Maine WordPress Hosting, Web Design and SEO/AEO services, Blazing fast WordPress Servers, full development team, Managed WP services.
hosting web designmainewordpressseoservices
https://www.piiperdigitalsolutions.com/
Piiper Digital Solutions | Home | Web Design & SEO Services
Piiper specializes in keeping our clients ahead of the competition through Increased Visibility, improved SEO Strategies, and executive Web Design services.
web design seodigital solutionsservices
https://s-fx.com/
Web Design & Managed IT Services for New Jersey Businesses
web design managednew jerseyservicesbusinesses
https://cucumberand.co/
Web Design, Video & AV Services in Beckley WV | Cucumber & Company
web design videoav servicesbeckley wvcucumbercompany
https://infostreamusa.com/
Web Design & Digital Marketing Services | InfoStream Solutions
Jul 10, 2024 - InfoStream Solutions is a web design and digital marketing company that helps companies and organizations develop and enhance their online brands.
web design digitalmarketing servicesinfostreamsolutions
https://atec-systems.com/
atec-systems – software design & web services
software designatecsystemswebservices
https://www.lachancedesign.com/
NH Web & Graphic Design Services - Website Designer & Developer
Jan 2, 2024 - Lachance Web Design, LLC is a full service graphic and website design firm. Located in Nashua, NH offering web design services to all New Hampshire areas and...
web graphic designnhservicesdesignerdeveloper
https://oscwebdesign.biz/
Custom Web Design, Development & Digital Marketing Services: Maine Web Design & Marketing | OSC Web...
Feb 17, 2025 - Are you ready to take your business to the next level? Good, because that's what we're here to help you do. Using our digital design and marketing expertise,...
custom web designdevelopment digital marketingservicesmaineosc
https://www.tenpine.ca/
Niagara Web Design and Digital Marketing Services | Tenpine
Need a website? We are a leading Niagara web design company offering digital marketing, hosting, domain registration, SEO, logo design and more.
digital marketing servicesweb designniagara
https://wixwebdesignservices.com/
WIX Web Design Services | WIX Website Design Services USA
wix web designservicesusa
https://hexxen.com/
Enterprise Web Design, Application Development, & Marketing / SEO Services
Jul 25, 2024 - Hexxen is a full-service marketing, web design, full-stack enterprise development technology agency. We serve as a key partner for businesses, professionals,...
enterprise web designapplication developmentmarketing seoservices
https://jeffersdesign.com/
Web & Graphic Design Services by Jeffers Design
web graphic designservicesjeffers
https://webdevinteractive.com/
Website Design Services for Barrie | Web Dev Interactive
Feb 13, 2026 - Looking to GROW YOUR BUSINESS with a WEBSITE but don't know where to go or who to trust? CALL us for a quick chat and we'll help answer ALL your questions!
design servicesweb devbarrieinteractive
https://www.allianceinteractive.com/
Web Design, Digital Marketing Agency & Website Maintenance Services
web design digitalmarketing agencymaintenanceservices
https://www.cssfounder.com/
Website Designing Company in India | Best Web Design Services in USA & Dubai
india best webdesign services usadesigning companydubai
https://www.sayenkodesign.com/professional-web-design/
Professional Web Design Services - Sayenko Design
Jan 5, 2026 - Looking for an Award-Winning Professional Web Design Company? Doing it right the first time costs less! Find out how our detailed process helps drive results.
professional web designservicessayenko
https://www.repletesoftware.com/
Leading IT company in INDIA for web design services, website developement services and Internet...
Welcome to Replete Software web services. We offer you best web design services, web developement services and internet marketing services at affordable price....
web design servicesleadingcompanyindiadevelopement
https://www.animink.com/
Charlotte Web Design Services and Website Development Company in NC - Animink
Sep 15, 2025 - Reach more customers and increase online visibility with Animink, a web design company which follows a systematic approach to deliver web design services in...
charlotte web designdevelopment companyservicesnc
https://sparkbusinessworks.com/
Custom Software Development & Web Design Services | SPARK
Apr 22, 2026 - SPARK provides custom software development and digital marketing services that help businesses increase efficiency and grow online.
custom software developmentweb design servicesspark
https://appleorangemarketing.com/
Web Marketing & Web Design Services | Apple Orange Marketing
Aug 22, 2022 - Over 20 years of experience building websites, web development, web marketing and more. Ask what Apple Orange Marketing can do for you!
marketing design serviceswebappleorange
https://www.ikaikakimura.com/
Hawaii Web Development Company | Website Design Services Hawaii Honolulu
Ikaika Kimura is Drupal web Development Company in Honolulu, Hawaii that provides creative web solutions and website design services.
web development companydesign serviceshawaiihonolulu
https://guruseoservices.com/
Red Deer SEO & Web Design Agency | Guru SEO Services
seo web designred deeragencyguruservices
https://prowebsitecreators.com/
Web Development Services for Small Business | Website Design Experts | Pro Website Creators
Apr 20, 2026 - Empower your business with professional web development services for small business. We build fast, beautiful, and conversion-focused websites designed to grow...
web development servicessmall businessdesign expertsprocreators
https://www.envisionup.com/
Digital Marketing Agency Canada - SEO, Web Design, PPC Services
Jan 29, 2026 - Save time and Money. Experts in Home Services Marketing, B2B Services and Charities and Associations. Certified Google Partner.
digital marketing agencyseo web designcanadappcservices
https://www.csdesignstudios.com/
Tucson Digital Marketing Agency - Web Design and SEO Services
Jun 26, 2025 - CS Design Studios is the trusted digital marketing company delivering exceptional SEO, Web Design and Social Media in Tucson. Call 520-908-6088.
digital marketing agencyweb designtucsonseoservices
https://themenepal.com/
Leading IT Company In Kathmandu| Best Web Design Services Cost | Theme Nepal
May 4, 2021 - Leading IT Company in Kathmandu, Nepal with the mission to build your business digitally via Website development. Software| Mobile development Services at best...
best web designservices costleadingcompanykathmandu
https://dynamicwebshop.com/
Cottonwood Arizona Web Design Services, Sedona AZ Web Design Services
Jan 23, 2026 - Discover excellence in Cottonwood Arizona Web Design Services, Sedona AZ Web Design Services with Dynamic Web Shop. Elevate your online presence with our expert
arizona web designcottonwoodservicessedonaaz
https://wheelhorsedigital.com/
Wheel Horse Digital | Springfield MA Web Design, SEO & Digital Marketing Services
Website design, SEO and sales funnel/email marketing services for small local businesses in Western Massachusetts
web design seohorse digitalwheelspringfieldmarketing
https://hokedesigns.com/
Hoke Designs: Your Local Source for Custom Web Design, Marketing, and Photography Services in...
Discover captivating web designs at HokeDesigns.com - your one-stop solution for innovative, responsive, and user-friendly websites. Elevate your online...
custom web designlocal sourcephotography serviceshokedesigns
https://stellarblue.ai/
StellarBlue.ai | Custom Artificial Intelligence & Web Design Services
ai customartificial intelligenceweb designservices
https://www.dimakhconsultants.com/
Website Design Company In Pune | Web Development Services In Pune
design companypune webdevelopmentservices
https://www.tseg.com/
Law Firm Digital Marketing | Legal Web Design Services
May 6, 2026 - Let TSEG run your Law Firm's digital marketing campaign. We offer web design, SEO and PPC services for law firms nationwide. Contact us to get started!
law firm digitalmarketing legalweb designservices
https://wris.com/
Website Design | WRIS Web Services
designwebservices
https://www.bloomrdesign.com/
Web Design and Web Development Services | Bloomr Design®
We offer branding, bespoke website design, and web development services for small businesses, AI companies, and start-ups.
web designdevelopment servicesbloomr
https://www.opuswebdesign.ie/
Website & Graphic Design Services | Opus Web Design | Cavan, Leitrim, Longford, Monaghan
graphic design servicesopuswebcavanleitrim
https://hyperponystudio.com/
Hyper Pony Studio – Web Design and Website Audits for the Financial Services Industry
Custom websites for the Financial Services industry. When you’re ready for a site that gets results, Hyper Pony Studio is ready to help!
web designfinancial serviceshyperponystudio
https://www.anaxdesigns.com/
Web Design Solutions, Responsive Web Design Services
Looking for custom responsive web design services for your business? Visit Anaxdesigns, we are the best web design solutions provider in the United States.
web design solutionsresponsiveservices
https://uswebcentral.com/
Web Design SEO Experts - Web Design & SEO Services Experts in South West Florida
May 12, 2026 - Cutting-edge AI SEO and intelligent WordPress websites that dominate search in Tampa, Sarasota, North Port, Port Charlotte, Venice, Cape Coral, Naples — and
web design seoexperts servicessouth westflorida
https://www.karks.com/
Eric Karkovack Web Design Services, LLC WordPress Web Development and Writing Services
Oct 14, 2025 - Eric Karkovack Web Design Services, LLC provides web development to Central Pennsylvania and beyond. Eric specializes in WordPress.
web design servicesllc wordpressericdevelopmentwriting
https://samanthadigital.com/
Web Design & SEO Services for Small Business | Samantha Digital
Jan 31, 2026 - Looking for a digital marketing agency in Virginia, Northern VA, Washington DC, or Maryland? Look no further than Samantha Digital LLC for...
web design seosmall businessservicessamanthadigital
https://www.appliedtactics.com/
Applied Tactics | Web Design, WordPress, Hosting, AI and SEO Services
web design wordpresshosting aiappliedtacticsseo
https://www.wizbit.net/
Cassette Tape, CD Duplication and WordPress Web Design & Development Services Hampshire, UK
May 17, 2021 - Wizbit provide both small run Cassette tape and CD duplication, and custom WordPress web and e-commerce development and page-flip brochures to companies in...
wordpress web designcassette tapecd duplicationdevelopment serviceshampshire
https://visibleone.com/services/website-design/
Web Design Hong Kong | Bespoke Website Design Services | Visible One
Choose Visible One, the premier web design company for your business. Our professional CMS and responsive designs come in affordable package.
web designhong kongbespokeservicesvisible
https://visualabdesign.com/
Web Design, Branding & SEO Services By Visualab Design
web design brandingseo services
https://www.dalejaleo.com/
Jaleo: Web Design Services for Real Estate Agencies in Spain, Costa del Sol, Costa Blanca
Apr 17, 2026 - We design real estate custom websites with WordPress + Inmobalia CRM. Based in Costa del Sol, our sites are easy to manage and grow. Serving Marbella,...
web design servicesreal estate agenciescosta del soljaleospain
https://www.bluetonemedia.com/
Local Web Design & Digital Marketing Agency | Expert SEO Services | Wilmington NC - BlueTone Media...
BlueTone Media offers expert web design and internet marketing services in Wilmington NC. Our solutions include SEO, PPC, custom WordPress designs, and more....
local web designdigital marketing agencyexpert seo serviceswilmingtonbluetone
https://az.design/
brand design consultancy: graphic + web design services - AZ Design
Dec 1, 2025 - We offer expert brand design consultancy, compelling graphic design and custom crafted websites. Helping SMEs develop + maintain their brand.
brand designgraphic webconsultancyservicesaz
https://www.hollysmalldesign.co.uk/
Web Design and Graphic Design Services | Holly Small Design
web designgraphic serviceshollysmall
https://www.foxwebcreations.com/
Kansas City Web Design & SEO Services - Fox Web Creations
We offer Kansas City Web Design and Website Development from the best web designers in Kansas City and WordPress SEO Experts.
kansas city webdesign seo servicesfoxcreations
https://snfwebdesign.com/
Skilled Nursing Facility Web Design Services | SNF Web Design
skilled nursing facilityweb design servicessnf
https://tinetrix.com/
Computer Repairs Franklin MA, Web Design, SEO, IT Services
Web Design in Franklin MA, IT Services, Computer Sales
web design seocomputer repairsfranklinservices
https://ioweb.my/
Web Design, Digital Marketing Services - Innovative Web Solutions for Businesses in Malaysia
Jun 20, 2025 - IOWEB.my offers cutting-edge web design, development, and digital solutions tailored for Malaysian businesses. Empower your online presence with professional...
web design digitalmarketing servicesinnovative solutionsbusinessesmalaysia
https://www.tdtrg.com/
Web Design, Development and Digital Marketing Services in NY
May 15, 2026 - Digi Tech Resources Group: Your Partner in Custom Websites, Mobile Apps, Digital Marketing, SEO, PPC, and Social Media Optimization Services.
web design developmentdigital marketing servicesny
https://www.rumahmedia.com/
RUMAH MEDIA: Web Design Bali | Digital Agency | SEO Services
We are Bali web developer, web design, SEO services, digital marketing agency, online course, mobile developer that will help create value for your business.
media web designdigital agency seorumahbaliservices
https://www.peaceloveweb.com/
Website Design Services | Pittsburgh, PA | Peace Love Web
PeaceLoveWeb, a Pittsburgh-based firm, creates attractive, mobile-friendly, and easy-to-manage websites; we also offer hosting, SEO, and logo design services.
services pittsburgh papeace lovedesignweb
https://alexfurfaro.com/columbus-web-design/
Columbus Web Design Services | Responsive Team | Alex Furfaro
web design servicescolumbusresponsiveteamalex
https://www.rustybrick.com/
Web Design, Web Development & Web Services New York, NY
Web site design and web development services in New York. Web Construction at its Best! - Click For More Information.
web design developmentservices new yorkny
https://www.webstix.com/
Web Design Madison WI, Website Development Services | Webstix
Webstix is a full-service web design and development company in Madison, WI, specializing in eCommerce, industrial sites, SEO, maintenance, and online...
web designmadison widevelopment services
https://www.elevateom.com/
UK Digital Marketing Services & Web Design | ElevateOM
uk digital marketingservices web design
https://twinrivers.net/
Web Design, Resume Services, Social Media & Blog Content
services social mediaweb designresumeblogcontent
https://mediag.com/
Web Design & Development Services | Metro Detroit | Media Genesis
Serving clients worldwide located in Metro Detroit, we’re a leader in all things web: eLearning, mobile applications, CMS, digital marketing and graphic design.
web design developmentservices metrodetroitmediagenesis
https://flipflopfreelance.com/
Seattle WordPress Web Design Services | Flip Flop Freelance
Jan 20, 2026 - Seattle-based web designer, Flip Flop Freelance, provides WordPress web design, web development, SEO, and maintenance services.
wordpress web designflip flopseattleservicesfreelance
https://firstcall-web.com/
Web Design & Marketing Services For Montana Businesses
Build lasting momentum with expert digital marketing and web design for Montana businesses.
web design marketingservicesmontanabusinesses
https://p8dmc.com/
Top Digital Marketing Agency in Bucks County PA, Web Design, SEO, PPC Services - Planet 8 Digital
top digital marketingbucks county paweb design seoppc servicesagency
https://www.fifteendesign.co.uk/website-design-services/web-design-development/
Web Design and Development Services | Fifteen
If you’re looking for web developers Nottingham who offer both web design and development services, Fifteen can help.
web designdevelopment servicesfifteen
https://thetechclouds.com/
Website Development Services | Leading Web Design Company
Mar 10, 2026 - The Tech Clouds is a leading web design and development company that crafts intuitive and scalable websites and web apps. Contact us today!
leading web designdevelopment servicescompany
https://www.justintimellc.net/
Just-in-Time Digital Marketing | Web Design & Digital Marketing Services in Connecticut
Grow your business with Just-in-Time Digital Marketing. We specialize in web design, SEO, branding, and digital marketing services tailored for small...
digital marketing webdesign servicestimeconnecticut
https://www.ssftech.co.uk/
Professional Web, Design & IT Services UK | Your Digital Growth Partner
professional web designservices ukdigital growthpartner
https://lawrank.com/
Law Firm SEO Agency | SEO, PPC, Web Design Services - LawRank
Apr 21, 2026 - Award-winning legal marketing agency specializing in SEO, PPC, Local SEO, and Web Design for attorneys and law firms.
law firm seoppc web designagencyserviceslawrank
https://yourbrandroots.com/
Web Design Services | Websites Built with Strategy
Apr 6, 2026 - Transform your website into a powerful tool with our expert web design services. Boost your business online today and work with the best Wordpress website...
web design serviceswebsites builtstrategy
https://www.damselflydigital.com/
Modern & Mindful Marketing Solutions: Web Design, Copy & Content Writing, PR & SEO Services
Asheville, NC-based freelance marketer offering modern, mindful and meaningful digital solutions. Certified brand growth strategist Erin Ratliff provides...
solutions web designcopy contentpr seomodernmindful