Robuta

https://www.yara.co.nz/news-and-events/ News and Media | Yara New Zealand yara newnewsmediazealand https://www.yara.co.nz/crop-nutrition/fertilisers/yaraliva/ YaraLiva - Calcium nitrate fertilisers | Yara New Zealand YaraLiva fertilisers contain fast-acting nitrate nitrogen, alongside strength-building calcium and boron for high value field crops. calcium nitratefertilisers yarayaralivanewzealand https://www.yara.co.nz/chemical-and-environmental-solutions/process-chemicals/ Process Chemicals | Yara New Zealand Process chemicals have been at the core of our business for over 100 years. Choose Yara and benefit from the expertise we have gained over that time. process chemicals yaranewzealand https://www.yara.co.nz/safety-data-sheets/ Safety data sheets | Yara New Zealand Safety data sheets for Yara products have been prepared in accordance with regulators. The data sheets are published in several languages. safety data sheetsyara newzealand https://www.yara.co.nz/crop-nutrition/crop-information/other-crops/ Other crops | Yara New Zealand yara newcropszealand https://www.yara.co.nz/crop-nutrition/fertiliser-handling-and-safety/fertiliser-security-and-safety/ Fertiliser security and safety | Yara New Zealand New chemical knowledge and new chemical legislations can cause phosphate fertilizers containing ammonium nitrate and other ingredients to be classified. These... safety yarafertilisersecuritynewzealand https://www.yara.co.nz/crop-nutrition/crop-information/arable-crops/ Arable crops | Yara New Zealand yara newarablecropszealand https://www.yara.co.nz/crop-nutrition/crop-information/general-block-fruit-crops/ Fruit crop fertiliser and nutrition advice | Yara New Zealand Are you looking for information on fruitcrop deficiencies? Or do you want to increase the yield or quality of your crops and need help choosing the right... nutrition adviceyara newfruitcropfertiliser https://www.yara.co.nz/chemical-and-environmental-solutions/ammonium-nitrates-electronics-grade/ Ammonium Nitrates Electronics Grade | Yara New Zealand Produce nitrous oxide that meets the exacting requirements of the electronics industry. yara newammoniumnitrateselectronicsgrade https://www.yara.co.nz/crop-nutrition/fertilisers/yaramila/ YaraMila - Compound fertilizers | Yara New Zealand A range of true uniform compound npk+s fertilisers containing nitrogen, phosphorus and potassium and in many cases sulphur in each granule or prill, assuring... yara newyaramilacompoundfertilizerszealand https://www.yara.co.nz/about-yara/careers/professionals/ Professionals | Yara New Zealand yara newprofessionalszealand https://www.yara.co.nz/crop-nutrition/fertilisers/ Fertilizers | Yara New Zealand yara newfertilizerszealand https://www.yara.co.nz/crop-nutrition/fertiliser-handling-and-safety/handling-and-transport/ Fertiliser handling and transport | Yara New Zealand It is important to handle and transport fertiliser safely whilst minimizing deterioration in quality. Correct handling and transportation of fertiliser should... yara newfertiliserhandlingtransportzealand https://www.yara.co.nz/crop-nutrition/fertiliser-handling-and-safety/environment-and-recycling/ Recycling fertiliser packaging | Yara New Zealand At Yara we're committed to continually reducing our environmental footprint. One way to do this is to reduce the amount of fertiliser packaging used and whilst... yara newrecyclingfertiliserpackagingzealand https://www.yara.co.nz/crop-nutrition/fertiliser-handling-and-safety/fertiliser-spreading/ Fertiliser spreading advice | Yara New Zealand When using fertilisers, the nutrients have to be spread accurately and evenly and at the right rate across the whole spreader width. A high quality fertiliser... yara newfertiliserspreadingadvicezealand https://www.yara.co.nz/about-yara/careers/internships/ Internships | Yara New Zealand yara newinternshipszealand https://www.yara.co.nz/chemical-and-environmental-solutions/scr-systems-and-urea-for-marine-engines/ SCR Systems and Urea for Marine Engines | Yara New Zealand Yara has a NOx reduction offer dedicated to the maritime sector, which is marketed under the NOxCare brand. Our comprehensive NOxCare offer for sea goin... yara newscrsystemsureamarine https://www.yara.co.nz/chemical-and-environmental-solutions/adblue-for-vehicles/ AdBlue® for Vehicles | Yara New Zealand AdBlue is a diesel exhaust fluid used in vehicles with Selective Catalytic Reduction (SCR) technology to reduce harmful gases being released into the... yara newvehicleszealand https://www.yara.co.nz/crop-nutrition/crop-information/veg-crops/ Vegetable crops | Yara New Zealand yara newvegetablecropszealand https://www.yara.co.nz/contact-us/ Contact us | Yara New Zealand Find contact details for our crop nutrition or chemical and environmental teams. yara newuszealand https://www.yara.co.nz/chemical-and-environmental-solutions/ Chemical and Environmental Solutions | Yara New Zealand environmental solutionsyara newchemicalzealand https://www.yara.co.nz/crop-nutrition/fertiliser-handling-and-safety/associations-and-certifications/ Fertiliser stewardship | Yara New Zealand Yara operates a fertiliser stewardship programme to ensure that proper care is taken along the whole fertiliser value chain from product development, purchase... yara newfertiliserstewardshipzealand https://www.yara.co.nz/crop-nutrition/fertilisers/yaratera/ YaraTera - Soluble fertilisers for fertigation | Yara New Zealand A complete range of fully soluble fertilisers for use in fertigation systems so both nutrients and water can be managed to maximise yield and quality yara newyaraterasolublefertilisersfertigation https://www.yara.co.nz/chemical-and-environmental-solutions/concrete-accelerator-admixture-/ Concrete Accelerator Admixture | Yara New Zealand Your customers need a way of accelerating concrete setting in hot or cold weather? Yara's NitCal in an admixture provides fast and reliable setting – and it... yara newconcreteacceleratorzealand https://www.yara.co.nz/about-yara/where-we-operate/ Where we operate | Yara New Zealand yara newoperatezealand https://www.yara.co.nz/contacts-nz/ Yara New Zealand contacts | Yara New Zealand yara newzealandcontacts https://www.yara.co.nz/crop-nutrition/fertiliser-handling-and-safety/storage-of-yaravita-products/ Storage of YaraVita products | Yara New Zealand Pallets of YaraVita fertilizer should be stored in racking. Where racking is not possible, follow the pallet stacking guidelines. Certain combinations of... yara newstorageyaravitaproductszealand https://www.yara.co.nz/crop-nutrition/ Crop Nutrition | Knowledge Grows | Yara New Zealand Yara crop nutrition knowledge and expertise can help maximise crop yield and quality. Find out more about all aspects of crop nutrition. crop nutritionyara newknowledgegrowszealand https://www.yara.co.nz/crop-nutrition/fertiliser-handling-and-safety/ifa-protect-sustain-program-product-stewardship/ IFA Protect & Sustain Program: Product Stewardship | Yara New Zealand Yara operates a Product Stewardship Program that ensures proper care is taken along the whole fertilizer value chain. product stewardshipyara newifaprotectsustain https://www.yara.co.nz/chemical-and-environmental-solutions/odour-nuisance-and-hs-prevention/ Odour Nuisance and H₂S Prevention | Yara New Zealand Toxic and foul smelling odors can pose serious health risks. Avoid smells with prevention and removal systems targeting H₂S and other noxious gases. yara newodournuisancepreventionzealand https://www.yara.co.nz/crop-nutrition/fertilisers/yarabela/ YaraBela - Nitrate fertilizers | Yara New Zealand yara newyarabelanitratefertilizerszealand https://www.yara.co.nz/search-results-page/ Search results | Yara New Zealand search resultsyara newzealand https://www.yara.co.nz/about-yara/ About Yara | Yara New Zealand Yara’s mission is both simple and very ambitious: to responsibly feed the world and protect the planet. Our crop nutrition solutions and precision farming... yara newzealand https://www.yara.co.nz/crop-nutrition/farmers-toolbox/conversion-calculator/ Conversion calculator | Yara New Zealand If you need to make a conversion we have a number of calculators available. conversion calculatoryara newzealand https://www.yara.co.nz/crop-nutrition/crop-information/ Solutions for crops | Yara New Zealand If you are looking to increase the quality and yield of a particular crop or just need more general advice on any aspect of crop nutrition. Search though our... yara newsolutionscropszealand https://www.yara.co.nz/crop-nutrition/fertilisers/yaraamplix-biostimulants/ Plant Biostimulants | YaraAmplix™ | Yara New Zealand YaraAmplix™ is our range of biostimulant products designed to strengthen crops against abiotic stress and enhances nutrient use efficiency. yara newplantbiostimulantszealand https://www.yara.co.nz/chemical-and-environmental-solutions/nox-reduction-for-industrial-plants/ NOx Reduction for Industrial Plants | Yara New Zealand Power plants as well as many industrial sites, such as cement, waste incinerators, glass manufacturing plants or refineries must increasingly be equipped with... nox reductionindustrial plantsyara newzealand https://www.yara.co.nz/crop-nutrition/fertiliser-handling-and-safety/fertiliser-labelling/ Fertiliser labelling | Yara New Zealand The label on the fertiliser bag contains important statutory information for transport, storage and handling of the fertiliser. The chemical composition of the... yara newfertiliserlabellingzealand https://www.yara.co.nz/about-yara/careers/ Careers | Yara New Zealand yara newcareerszealand