https://awfulannouncing.com/nba/what-the-data-actually-says-about-mlb-and-nba-popularity.html
What the data actually says about MLB and NBA popularity
Mar 26, 2026 - Many people have strong emotions about whether the NBA or MLB is more popular. But what does the data say?
data actuallysaysmlbnbapopularity
https://www.surmado.com/blog/ai-visibility-measurement
The GEO Measurement Problem: What AI Actually Says About Your Business | Surmado Blog
Dec 1, 2025 - Everyone talks about AI search optimization. Almost no one measures results. Here's how to fix that.
ai actuallygeomeasurementproblemsays
https://enests.co/blog/choosing-a-stye-treatment-spray-what-the-science-actually-says
Choosing a Stye Treatment Spray: What the Science Actually Says | Enests
May 8, 2026 - A stye is a common eyelid condition that often begins with redness, swelling, and discomfort near the lash line. Many individuals search for quick relief...
actually sayschoosingstyetreatmentspray
https://www.ibtimes.co.uk/canada-euthanasia-law-viral-claim-debunked-1779213
Canada 'Euthanizing Babies' Claim Goes Viral — What the Country's MAID Law Actually Says | IBTimes...
Feb 16, 2026 - Discover the truth about Canada's euthanasia law and fact-check the viral claim suggesting that babies from impoverished families are being euthanized.
goes viralactually sayscanadababiesclaim
https://www.morphllm.com/will-ai-replace-developers
Will AI Replace Developers? What the Research Actually Says (2026) | Morph
An AI infrastructure company's honest assessment. The METR RCT found AI made experienced developers 19% slower. Bain measured 10-15% productivity gains,...
ai replaceactually saysdevelopersresearchmorph
https://vitadash.app/blog/optimal-vitamin-d-levels
Optimal Vitamin D Levels: What the Research Actually Says About the Ideal Range - VitaDash Blog |...
actually saysoptimalvitaminlevelsresearch
https://volarescort.com/what-your-dating-app-choice-says-about-you/
What Your Choice of Dating App Actually Says About You | VolarEscort - Erotic Lifestyles and Adult...
dating appactually sayschoiceeroticlifestyles
https://getsteps.app/blog/10000-steps-a-day-benefits
10,000 Steps a Day Benefits: What Science Actually Says - Steps Blog | Steps: Workout & Pedometer
Feb 16, 2026 - Walking 10,000 steps daily reduces heart disease risk by 50%, burns 300-500 calories, and improves mental health. Backed by research from JAMA and Harvard.
actually saysstepsdaybenefitsscience
https://www.prweb.in/article/525/myths-about-protein-intake-what-the-research-actually-says
Myths About Protein Intake — What the Research Actually Says - PRWeb.in
The average American already eats roughly 100 grams of protein per day — well above the Recommended Dietary Allowance of 0.8 grams per kilogram of body weigh...
protein intakeactually saysmythsresearchprweb
https://humanbenchmark.now/blog/cognitive-training
Cognitive Training: What the Science Actually Says — Human Benchmark Blog
May 3, 2026 - An honest look at cognitive training methods — which ones genuinely transfer to real-world improvements and which only improve your score on one specific game.
cognitive trainingactually sayshuman benchmarkscienceblog
https://www.foodpoisoningnews.com/organic-foods-and-risk-of-food-poisoning-what-the-evidence-actually-says/
Organic Foods and Risk of Food Poisoning: What the Evidence Actually Says | Food Poisoning News
Apr 21, 2026 - Organic food has become synonymous with health, purity, and safety in the minds of many consumers. Grocery stores prominently display organic labels, often at
organic foodsactually saysriskpoisoningevidence
https://www.mmamania.com/ufc-328-live-stream-fight-card-start-time-how-to-watch/441651/khamzat-chimaev-says-he-loves-sean-strickland-actually-ufc-pay-good-for-him
Chimaev says he ‘loves’ Strickland, actually: ‘UFC pay good for him’ | MMA Mania
May 6, 2026 - Sean Strickland can say what he wants about Khamzat Chimaev because Chimaev is getting paid extremely well for this UFC 328 fight.
chimaevsaysstricklandactuallypay
https://www.sofiadate.com/dating-tips/how-to-make-your-girlfriend-happy
How to Make Your Girlfriend Happy: What the Research Actually Says
Want to make your girlfriend happy? Discover specific, research-backed behaviors — from love languages to quality time — that actually strengthen your...
makegirlfriendhappyresearchactually
https://www.capitalfm.com/news/tv-film/married-at-first-sight/australia-mafs-mel-luke-rings-fake/
MAFS Australia star says Luke forgetting wedding rings was actually staged - Capital
Mar 23, 2026 - Married At First Sight Australia's Eliot Donovan has claimed producers ‘clearly set up’ Luke Fourniotis to forget the wedding rings.
mafs australiawedding ringsstarsaysluke
https://barbend.com/greens-powders/
Do Greens Powders Actually Work? Here's What the Science Says | BarBend
Mar 13, 2025 - Can you really get all your veggies in a pill or powder? The science might say otherwise. Here's what's going on behind the scenes.
actually workscience saysgreenspowdersbarbend
https://www.360apprenticeships.co.uk/
The ROI of Apprenticeships: What the Data Actually Says
Apr 7, 2025 - Leading apprenticeships company in Manchester specialising in multi-channel marketing and business administration work based qualifications.
data actuallyroiapprenticeshipssays
https://www.lbc.co.uk/article/openai-elon-musk-altman-5HjdYkt_2/
'I actually thought he was going to hit me' OpenAI President says of Elon Musk | LBC
May 6, 2026 - Tesla CEO Elon Musk is suing OpenAI's Chief Executive Sam Altman and President Greg Brockman
president sayselon muskactuallythoughtgoing
https://babylonbee.com/news/newsom-says-california-population-is-actually-growing-if-you-dont-count-all-the-people-who-are-leaving
Newsom Says California Population Is Actually Growing If You Don't Count All The People Who Are...
SACRAMENTO, CA — Governor Gavin Newsom proudly announced over the weekend that the population of California was on the rise, as long as you don't count all the...
newsomsayscaliforniapopulationactually