https://developers.google.com/terms/api-services-user-data-policy
Google API Services User Data Policy | Google for Developers
google api servicesuser data policyfor developers
https://nordicapis.com/3-methods-for-documenting-json-api-services/
3 Methods for Documenting JSON API Services | Nordic APIs |
Nov 12, 2024 - We look at general methods to document JSON web services. Use 3rd party solutions, base docs off framework, or manually create an API wiki / knowledge base.
json apimethodsdocumentingservicesnordic
https://www.vibemart.app/learn/api-services/automate-tasks
API Services That Automate Repetitive Tasks | Vibe Mart | Vibe Mart
Browse API Services that Automate Repetitive Tasks on Vibe Mart. AI-built apps combining Backend APIs and microservices generated with AI with Apps that...
api servicesautomaterepetitivetasksvibe
https://pkg.go.dev/github.com/caoruidong/containerd/api/services/diff/v1
diff package - github.com/caoruidong/containerd/api/services/diff/v1 - Go Packages
Package diff is a generated protocol buffer package.
api servicesdiffpackagegithubcontainerd
https://www.apisecurity.us/
API Services, INC in Worthington | Security & Property Improvements
Find security and property improvement solutions with API Services, INC in Worthington. Contact us today!
api servicesproperty improvementsincworthingtonsecurity
https://developers-dot-devsite-v2-prod.appspot.com/youtube/terms/api-services-terms-of-service?authuser=0
YouTube API Services Terms of Service | Google for Developers
youtube api servicesgoogle for developersterms of
https://support.quest.com/vranger/kb/4042639/service-vranger-api-services-vapihost-has-zero-application-non-infrastructure-endpoints
Service 'vRanger.API.Services.VAPIHost' has zero application (non-infrastructure) endpoints...
Service cannot be started. System.InvalidOperationException: Service 'vRanger.API.Services.VAPIHost' has zero application (non- 4042639
api serviceszeroapplicationnoninfrastructure
https://dataplatform.cloud.ibm.com/docs/content/wsj/mdm/query-api.html?context=cpdaas&context=cpdaas&audience=wdp&locale=en&locale=ja
API services available in IBM Master Data Management | IBM Cloud Pak for Data as a Service
IBM Master Data Management provides a powerful REST API that can connect its powerful master data matching capabilities to your systems and processes. Use the...
master data managementapi servicesavailable incloud pakibm
https://www.airtel.in/b2b/sms-api
SMS API Services and messaging solutions for business by Airtel
Apr 10, 2026 - Discover seamless communication enhancement with Airtel SMS API services. Upgrade customer experience and business processes through our reliable messaging API...
solutions for businesssms apiservicesmessagingairtel
https://www.precisely.com/legal/licensing/api-services-agreement-prior-versions/
API Services Agreement (prior versions) | Precisely
api servicesprior versionsagreementprecisely
https://www.lagomframework.com/documentation/1.1.x/java/api/com/lightbend/lagom/javadsl/api/package-frame.html
com.lightbend.lagom.javadsl.api (Lagom Services API)
api serviceslightbendlagom
https://github.com/googleapis/java-storage-nio/pull/428
deps: update dependency com.google.apis:google-api-services-storage to v1-rev20210127-1.31.0 by...
Contribute to googleapis/java-storage-nio development by creating an account on GitHub.
google apisdepsupdatedependencyservices
https://developer.adobe.com/experience-manager/reference-materials/6-5/forms/javadocs/com/adobe/fd/ccm/ccr/ccrDocumentInstance/api/services/package-use.html
Uses of Package com.adobe.fd.ccm.ccr.ccrDocumentInstance.api.services (AEM Forms API)
api servicesusespackageadobefd
https://deepwiki.com/midas-research/audino/4.5-api-services-layer
API Services Layer | midas-research/audino | DeepWiki
This page documents the frontend service modules located in `audino-frontend/src/services/`. These modules form the complete HTTP interface between the React...
api serviceslayermidasresearchdeepwiki
https://ecomuch.com/what-are-the-best-free-api-services/
What Are the Best Free API Services? - Ecomuch
Apr 27, 2023 - A lot of individuals are aware of the function that an API serves, but a lot of people are not. A bridge that connects two systems in a language that both
what arethe bestfree apiservices
https://www.gname.com/domain/api
GNAME | API Services: Integrate without extensive development
Streamline your domain management with GNAME's powerful API services. Seamlessly search, register, renew, transfer, and manage your domains. Retrieve domain...
api servicesgnameintegratewithoutextensive
https://www.pulumi.com/docs/reference/cloud-rest-api/services/
Pulumi Cloud REST API: Services | Pulumi Docs
Group and organize related Pulumi Cloud resources into Services, which are collections of resources that work together to provide a specific capability.
rest apipulumicloudservicesdocs
https://www.sellersprite.com/affiliate/BBS35
SellerSprite Pricing: Plans, Add Ons & API Services
Compare SellerSprite pricing across plans, add ons, and API services. Pick what fits your workflow and scale with confidence. Questions? Contact us anytime.
pricing plansadd onsapi services
https://www.almacgroup.com/event_business_unit/api-services-chemical-development/?cc=US
API Services & Chemical Development - Almac
api serviceschemicaldevelopment
https://www.anna-dsb.com/download/2024-08-02-informational-notice-dsb-uat-fix-isin-only-api-services-brief-disconnection/
2024-08-02 INFORMATIONAL NOTICE DSB UAT FIX ISIN Only API Services Brief Disconnection - DSB
api servicesinformationalnoticedsbuat
https://en.bitcoin.it/w/index.php?title=Bitcoin_API_Services&action=history
Bitcoin API Services: Revision history - Bitcoin Wiki
api servicesrevision historybitcoinwiki
https://www.gmfleet.com/software/onstar/api-data-services
OnStar API Services | GM Fleet
Leverage OnStar API Services to integrate real-time vehicle data into your business systems. Enhance operations with advanced insights and connectivity.
api servicesgm fleetonstar
https://apitube.io/en-pl/compare
Compare different news API Services | APITube.io News API
Numerous providers offer news APIs, but here's why we believe apitube.io stands out as the top choice for your needs.
news apicomparedifferentservicesio
https://www.devcurry.com/2013/08/building-knockoutjs-based-client-for_16.html
Building a Knockout.js based client for Web API services in an ASP.NET MVC app
A mashup using ASP.NET MVC and KnockoutJS to build a simple templated UI that retrieves data from Web API Services.
building aknockout jsfor webapi servicesasp net
https://maven.apache.org/ref/4-LATEST/api/maven-api-core/apidocs/org/apache/maven/api/services/class-use/ModelBuilderRequest.html
Uses of Interface org.apache.maven.api.services.ModelBuilderRequest (Maven 4 API :: Core...
use: package: org.apache.maven.api.services, interface: ModelBuilderRequest
apache mavenapi servicesusesinterfacecore
https://developer.zuelpay.com/
Looking for API services in India?
looking forapi servicesindia
https://help.sbobet.com/article/do-you-offer-xml-feeds-and-api-services-598.html
Do you offer XML feeds and API services? - SBOBET Information Center
SBOBET Help - FAQ - Visit SBOBET Affiliates to learn more about marketing tools such as XML feeds and API services.
you offerxml feedsapi servicesinformation centersbobet
https://triblem.in/
Triblem India - Official WhatsApp Business API Services
Triblem India provides Official WhatsApp Business API services for businesses. Automate messaging, boost customer engagement, and scale your communication.
whatsapp business apiindiaofficialservices
https://agencypartner.com/services/
Explore API Services | Digital Marketing, Web & Mobile App Development Services
Aug 27, 2025 - Unlock your brand's potential with Agency Partner Interactive's services in digital marketing, web and mobile app development. Elevate your online presence and...
mobile app developmentexplore apidigital marketingservicesweb
https://docs.netapp.com/us-en/ontap-tools-vmware-vsphere-910/configure/task_register_oncommand_api_services_with_ontap_tools.html
Register OnCommand API Services with ONTAP tools
If you are using ONTAP 9.6 or earlier, then the vVols dashboard can display the details of VMware Virtual Volumes \(vVols\) datastores and virtual machines o...
api servicesregisterontaptools
https://pintel.ai/googleapidisclouser
Google API Services Usage Disclosure - Pintel.AI
Disclosure regarding Pintel.AI's use and transfer of information received from Google APIs.
google api servicesusagedisclosureai
https://africa.businessinsider.com/local/markets/how-binance-is-ensuring-compliance-through-its-updated-api-services-to-ensure-a-safe/h2d0h7g
How Binance is ensuring compliance through its updated API services to ensure a safe and...
In creating a world where millions of people can come to participate in the ever-evolving cryptocurrency ecosystem to enjoy the freedom of money and financial...
api servicesbinancecomplianceupdatedensure
https://developer.mescius.com/componentone/docs/webapi/online-webapi/overview/WorkingwithC1WebAPI/configuring-the-client-application/ClientAppRESTApiServices
Client Application for REST Api Services
client applicationrest apiservices
https://www.leaderonomics.com/articles/business/business-owners-benefit-weather-api-services
How Business Owners Can Benefit from Weather API Services | Leaderonomics
Dec 29, 2025 - As governments worldwide take action through policies and regulations, businesses must also adapt accordingly.
can benefit frombusiness ownersweather apiservices
https://www.marketscreener.com/news/tianju-dihe-extends-api-services-agreement-with-jd-com-unit-ce7e51ded98df524
Tianju Dihe Extends API Services Agreement with JD.com Unit | MarketScreener
Mar 31, 2026 - Tianju Dihe Technology renewed its API interface service agreement with a unit of JD.com , according to a Tuesday Hong Kong bourse filing. Under the agreement,...
api servicesextendsagreementjdunit
https://papaly.com/raphaelmansuy/ehcp5/API-Services
API Services - raphaelmansuy | Papaly
API Services - Raphael Mansuy - GraphQL, API | Papaly
api services
https://arbaan.com/
Your go-to digital partner in all integration, automation, and API services
Jun 24, 2025 - Services that are tailor made to the businesses of all sizes ranging from small to medium to enterprise levels.
go todigital partnerin allapi servicesintegration
https://www.zolute.consulting/services/q/meta-cloud-api?page=0
meta cloud api - Services | Zolute
Hire professional IT consulting service provider in for meta cloud api
cloud apimetaservices
https://community.ctrader.com/forum/connect-api-support/10554/
cTrader Forum - API services down
cTrader forum. Discussion about API services down
api servicesctraderforum
https://dadaodb.com/
DaDao DB - Financial Data API Services
Enterprise-grade financial data API services for modern businesses
financial data apidbservices
https://habr.com/en/articles/894406/
Top Web Parsers and API Services for Data scraping: A Comparison of Speed, Scalability, and...
Automatic data scraping (parsing) has become an essential practice for developers, analysts, and automation specialists. It is used to extract massive amounts...
api servicesdata scrapingtopwebparsers
https://www.helpnetsecurity.com/2020/06/04/composer-js/
Composer.js: Framework and toolset for rapidly building back-end API services using NodeJS - Help...
Jun 4, 2020 - AcceleratXR announced the launch of its new open source project - Composer.js. Composer.js is a framework and toolset for rapidly building back-end API
back endapi servicescomposerjsframework
https://docs.pingidentity.com/pingone/authorization_using_pingone_authorize/p1az_adding_custom_policies_for_api_services_and_operations.html
Adding custom policies for API services and operations | PingOne
With an API gateway integration, you can define custom policies that target inbound requests and outbound responses for API services and operations.
api servicesaddingcustompoliciesoperations
https://www.ufz.de/arcgis/sdk/rest/02ss/02ss00000057000000.htm
ArcGIS REST API - ArcGIS Services - Working with services you've published
Working with services you've published The ArcGIS REST API, short for Representational State Transfer, provides a simple, open web interface to ArcGIS. A major...
working with yourest apiarcgisservicespublished
https://clickchat.io/
Click Chat | AI Automation Solution | Whatsapp Business API Services Provider
Grow your business with WhatsApp Business API and AI automation. Send bulk messages, automate support, and drive sales with secure, scalable solutions.
ai automation solutionwhatsapp business apiservices providerchat
https://madanswer.com/APIGEE%20-%20API%20Services
Recent questions and answers in APIGEE - API Services - Madanswer Technologies Interview Questions...
APIGEE API Services Interview Questions Answers. APIGEE API Services Fresco Questions and Answers
questions and answersapi servicesrecentapigeetechnologies
https://www.noblewebstudio.com/blog/aeps-solution-for-fintech-businesses-retailers/
Best AEPS Solution for Retailers and CSPs in India | Secure AEPS API Services by Noble Web Studio
May 13, 2026 - Looking for the best AEPS solution for retailers and CSPs in India? Noble Web Studio provides secure AEPS API integration, Aadhaar Enabled Payment System...
solution forapi servicesnoble webbestaeps
https://developers.google.cn/youtube/terms/api-services-terms-of-service-emea-nl
YouTube API Services Terms of Service (EMEA) | Google for Developers
youtube api servicesgoogle for developersterms ofemea
https://lemon.io/answers/google-api-services/
Google API Services Questions and Answers - Lemon.io
Lemon.io has answers to all your Google API Services questions
google api servicesquestions and answerslemon
https://docs.azure.cn/en-us/ai-services/computer-vision/how-to/call-read-api
Call the Azure AI Vision v3.2 GA Read API - Azure AI services | Azure Docs
Learn how to call the Azure AI Vision v3.2 GA Read API and configure its behavior in detail.
azure aiapi servicescallvisionga
https://docs.oracle.com/cd/E28280_01/apirefs.1111/e14650/oracle/security/jps/config/PropertySet.html
PropertySet (Oracle Fusion Middleware Java API Reference for Oracle Platform Security Services)
oracle fusion middlewarejava api referenceplatform securityservices
https://helpcenter.veeam.com/archive/backup/110/hyperv/storage_configure_enable_web.html
Step 1. Enable HPE 3PAR Web Services API Server - User Guide for Microsoft Hyper-V
web services apiuser guidestepenablehpe