Robuta

https://californiawalnuts.ca/ California Walnuts Canada | Recipes, Nutrition & Plant-Based Goodness May 20, 2026 - Discover California Walnuts — a versatile, plant-based source of omega-3 ALA. Explore recipes, nutrition facts, and ideas to power up every meal. california walnutscanada recipesplant basednutritiongoodness https://noixdegrenoble.ca/ California Walnuts Canada | Recipes, Nutrition & Plant-Based Goodness May 20, 2026 - Discover California Walnuts — a versatile, plant-based source of omega-3 ALA. Explore recipes, nutrition facts, and ideas to power up every meal. california walnutscanada recipesplant basednutritiongoodness https://www.kraftheinz.com/en-CA/maxwell-house/recipes/574829-awake-peanut-butter-snack-bites Awake Peanut Butter Snack Bites | Maxwell House | Canada | Recipes - Kraft Heinz Try our super easy and super yummy recipe for Awake Peanut Butter Snack Bites. Ground coffee and chunks of white and semi-sweet chocolate create a wonderful... peanut buttermaxwell housecanada recipesawakesnack https://www.kraftheinz.com/en-CA/kraft-miracle-whip/recipes/532933-miracle-whip-make-ahead-buffet-salad MIRACLE WHIP Make-ahead Buffet Salad | Kraft Miracle Whip | Canada | Recipes - Kraft Heinz This layered salad recipe is a classic: The layers of crisp greens, bite-size veggies, grated cheese, crumbled bacon and creamy dressing combine for a... miracle whipmake aheadkraft canadabuffetsalad https://www.kraftheinz.com/en-CA/philadelphia/recipes/552561-philadelphia-new-york-style-sour-cream-topped-cheesecake PHILADELPHIA New York-Style Sour Cream-Topped Cheesecake | Philadelphia | Canada | Recipes - Kraft... This traditional sour cream cheesecake is always a favourite among our readers. Its richness is balanced by a ripe strawberry fruit topping. Now made in a... philadelphia new yorksour creamcanada recipesstyle https://www.kraftheinz.com/en-CA/kool-aid/recipes/500057-pastel-angel-cake Pastel Angel Cake | KOOL-AID | Canada | Recipes - Kraft Heinz Angel food cake gets a colourful twist in this sweet and simple dessert. With the addition of cherry KOOL-AID, a boxed angel food cake mix goes from classic to... angel cakekool aidcanada recipespastelkraft https://www.kraftheinz.com/en-CA/philadelphia/recipes/536748-philly-3-step-oreo-cheesecake PHILLY 3-Step OREO Cheesecake | Philadelphia | Canada | Recipes - Kraft Heinz Everybody's favourite cheesecake just got a whole lot easier to make at home! Follow our 3 simple steps to OREO Cheesecake greatness. oreo cheesecakecanada recipesphilly3step https://www.kraftheinz.com/en-CA/kraft-cool-whip/recipes/566601-pistachio-layered-dessert Pistachio Layered Dessert | Kraft Cool Whip | Canada | Recipes - Kraft Heinz Pistachio Layered Dessert layered dessertcool whipcanada recipespistachiokraft https://www.kraftheinz.com/en-CA/renees/recipes/577840-asian-chicken-rice-noodle-salad Asian Chicken Rice Noodle Salad | RENEES | Canada | Recipes - Kraft Heinz This is a super easy and a wonderfully tasty salad recipe. chicken rice noodlecanada recipesasiansaladkraft https://www.kraftheinz.com/en-CA/velveeta/recipes/550203-velveeta-buffalo-chicken-dip VELVEETA Buffalo Chicken Dip | Velveeta | Canada | Recipes - Kraft Heinz If you're the kind of person who likes to take home an empty dish after the potluck party, we recommend bringing this creamy Buffalo chicken dip. buffalo chicken dipcanada recipesvelveetakraftheinz https://www.kraftheinz.com/en-CA/maxwell-house/recipes/572723-creamy-coconut-tiramisu Creamy Coconut Tiramisu | Maxwell House | Canada | Recipes - Kraft Heinz Our Creamy Coconut Tiramisu has everything you love about classic tiramisu, with a tropical twist. Made with coconut milk and flaked coconut, this tiramisu... creamy coconutmaxwell housecanada recipestiramisukraft https://www.kraftheinz.com/en-CA/kraft-salad-dressing/recipes/584465-country-chicken-pie Country Chicken Pie | Kraft Salad Dressing | Canada | Recipes - Kraft Heinz Move over chicken pot pie! This twist has a deliciously cheesy, saucy chicken filling nestled between, not one, but two flaky crusts. This hearty chicken pie... country chickensalad dressingcanada recipespiekraft https://www.kraftheinz.com/en-CA/maxwell-house/recipes/548993-vanilla-chai-coffee-cooler Vanilla Chai-Coffee Cooler | Maxwell House | Canada | Recipes - Kraft Heinz This beverage is a coffee-shop fave that you can make at home. Chill out with our Vanilla Chai-Coffee Cooler - perfect for a mid-day break. vanilla chaicoffee coolermaxwell housecanada recipeskraft https://www.kraftheinz.com/en-CA/maxwell-house/recipes/503535-harvest-coffee-cider Harvest Coffee Cider | Maxwell House | Canada | Recipes - Kraft Heinz Flavoured with coffee and cinnamon, this hot cider is a twist on a traditional fall beverage. harvest coffeemaxwell housecanada recipesciderkraft https://www.kraftheinz.com/en-CA/kraft-shake-n-bake/recipes/536820-shake-n-bake-alongs SHAKE'N BAKE Alongs | Kraft Shake n Bake | Canada | Recipes - Kraft Heinz Greet them with the classic smell of oven baked chicken. shake n bakekraft canadaalongsrecipesheinz https://www.kraftheinz.com/en-CA/philadelphia/recipes/556448-creamy-lemon-squares Creamy Lemon Squares | Philadelphia | Canada | Recipes - Kraft Heinz These lemon squares are a creamy twist of the classic recipe that you have to taste to believe. lemon squarescanada recipescreamyphiladelphiakraft https://www.kraftheinz.com/en-CA/jell-o/recipes/503104-chocolate-bunny-cake Chocolate Bunny Cake | Jell-O | Canada | Recipes - Kraft Heinz Every bunny likes bunny cake! Especially when said bunny is made from a blend of chocolate cake mix and pudding, and topped with coconut and marshmallows. chocolate bunnycanada recipescakejellkraft https://www.kraftheinz.com/en-CA/certo/recipes/557326-cooked-apricot-jam-certo-crystals Cooked Apricot Jam - CERTO Crystals | Certo | Canada | Recipes - Kraft Heinz Just three simple ingredients - fresh apricots, sugar and CERTO Pectin Crystals - are needed to prepare this easy-to-make cooked jam recipe. Buy apricots when... apricot jamcanada recipescookedcertocrystals https://www.kraftheinz.com/en-CA/classico/recipes/583093-pumpkin-lasagna Pumpkin Lasagna | Classico | Canada | Recipes - Kraft Heinz Our Pumpkin Lasagna recipe is sure to become a new fall favourite. This Pumpkin Lasagna brings together pumpkin, creamy Alfredo sauce and cheesy noodles in an... canada recipespumpkinlasagnaclassicokraft https://www.kraftheinz.com/en-CA/velveeta/recipes/4SKoQ6Q9Yvq5wHzLF1s12V-cheesy-shells-with-tomatoes-and-corn Cheesy Shells with Tomatoes and Corn | Velveeta | Canada | Recipes - Kraft Heinz canada recipescheesyshellstomatoes https://www.kraftheinz.com/en-CA/velveeta/recipes/502141-double-cheese-broccoli-soup Double-Cheese Broccoli Soup | Velveeta | Canada | Recipes - Kraft Heinz This broccoli soup is delicious, warm and guaranteed to make cold fingers toasty again, not to mention hearty and velvety with chopped broccoli and creamy... double cheesebroccoli soupcanada recipesvelveetakraft https://www.kraftheinz.com/en-CA/classico/recipes/548496-simply-lasagna Simply Lasagna | Classico | Canada | Recipes - Kraft Heinz Making lasagna has never been easier! canada recipessimplylasagnaclassicokraft https://www.kraftheinz.com/en-CA/certo/recipes/573606-cooked-raspberry-jam-certo-crystals Cooked Raspberry Jam - CERTO Crystals | Certo | Canada | Recipes - Kraft Heinz Combine fresh raspberries, sugar and CERTO Pectin Crystals to make this delicious ruby-red jam that your friends and family are sure to enjoy. raspberry jamcanada recipescookedcertocrystals https://www.kraftheinz.com/en-CA/kraft-salad-dressing/recipes/551742-russian-chicken-breasts Russian Chicken Breasts | Kraft Salad Dressing | Canada | Recipes - Kraft Heinz An elegant but easy chicken dish to prepare for entertaining. chicken breastssalad dressingcanada recipesrussiankraft https://www.kraftheinz.com/en-CA/kraft-cool-whip/recipes/578731-cool-whip-walnut-blondies COOL WHIP Walnut Blondies | Kraft Cool Whip | Canada | Recipes - Kraft Heinz Serve these COOL WHIP Walnut Blondies with a pot of hot coffee for a delectable homemade treat! cool whipkraft canadawalnutblondiesrecipes https://www.kraftheinz.com/en-CA/jet-puffed/recipes/524906-ghost-goo Ghost Goo | Jet-Puffed | Canada | Recipes - Kraft Heinz This is the only dessert dip you'll need for your Halloween party buffet! This creamy Ghost Goo is delicious with assorted fruit. canada recipesghostgoojetpuffed https://www.kraftheinz.com/en-CA/certo/recipes/557325-cooked-blueberry-jam-certo-crystals Cooked Blueberry Jam - CERTO Crystals | Certo | Canada | Recipes - Kraft Heinz Yes, even you can make jam! The CERTO Pectin Crystals are a quick and easy way to make homemade jams. This virtually foolproof recipe for Cooked Blueberry Jam... blueberry jamcanada recipescookedcertocrystals https://www.kraftheinz.com/en-CA/philadelphia/recipes/586451-everything-bagel-dip-with-veggies Everything Bagel Dip with Veggies | Philadelphia | Canada | Recipes - Kraft Heinz Everything bagel seasoning is not just for bagels anymore. This flavourful seasoning blend can be sprinkled over, or added to, a variety of foods. Add it to a... everything bagelcanada recipesdipveggiesphiladelphia https://www.kraftheinz.com/en-CA/certo/recipes/532361-red-currant-jelly Red Currant Jelly | Certo | Canada | Recipes - Kraft Heinz Transform a crop of fresh red currants into gleaming jars of Red Currant Jelly. Follow our simple steps to homemade jam - you'll wonder why you didn't try it... red currantcanada recipesjellycertokraft https://www.kraftheinz.com/en-CA/kraft-salad-dressing/recipes/585941-loaded-baked-potato-skins-casserole Loaded Baked Potato Skins Casserole | Kraft Salad Dressing | Canada | Recipes - Kraft Heinz A flavourful, comforting casserole prepared with potatoes jazzed up with ranch dressing, sour cream, shredded cheese and crisply cooked bacon. This is the dish... loaded baked potatosalad dressingcanada recipesskinscasserole https://www.kraftheinz.com/en-CA/philadelphia/recipes/585925-one-pot-creamy-chicken-tuscan-pasta One-Pot Creamy Chicken Tuscan Pasta | Philadelphia | Canada | Recipes - Kraft Heinz Get dinner done fast with our One-Pot Creamy Chicken Tuscan Pasta. This chicken Tuscan pasta is made of pantry staples, so it's a one-pot wonder! one potcreamy chickencanada recipestuscan https://www.kraftheinz.com/en-CA/taco-bell/recipes/2QdzbkO2lc2okP28KECQnb-cheesy-fiesta-nachos Cheesy Fiesta Nachos | TACO BELL | Canada | Recipes - Kraft Heinz taco bellcanada recipescheesyfiestanachos https://www.kraftheinz.com/en-CA/jell-o/recipes/535883-creamy-jell-o-layers Creamy JELL-O Layers | Jell-O | Canada | Recipes - Kraft Heinz Whip up a fun and fruity dessert in minutes with just 2 ingredients - JELL-O and COOL WHIP are the shortcuts in this simple layered dessert recipe. jell ocanada recipescreamylayerskraft https://www.kraftheinz.com/en-CA/kraft-stove-top/recipes/545058-bruschetta-chicken-bake Bruschetta Chicken Bake | Kraft Stove Top | Canada | Recipes - Kraft Heinz bruschetta chicken bakestove topcanada recipeskraftheinz https://www.kraftheinz.com/en-CA/certo/recipes/529337-certo-saskatoon-jelly CERTO Saskatoon Jelly | Certo | Canada | Recipes - Kraft Heinz Our Saskatoon berry jelly is a delightfully sweet Canadian treat. Made with fresh Saskatoon berries, lemon juice, sugar and pectin, this homemade jelly is a... canada recipescertosaskatoonjellykraft https://www.kraftheinz.com/en-CA/kraft-salad-dressing/recipes/585927-taco-pinwheels Taco Pinwheels | Kraft Salad Dressing | Canada | Recipes - Kraft Heinz In need of an easy and cheesy appetizer? Try these Taco Pinwheels. These delicious appetizers are guaranteed to win rave reviews from friends and family alike.... salad dressingcanada recipestacopinwheelskraft https://www.kraftheinz.com/en-CA/kraft-shake-n-bake/recipes/526430-shake-n-bake-mexican-turkey-rolls SHAKE'N BAKE Mexican Turkey Rolls | Kraft Shake n Bake | Canada | Recipes - Kraft Heinz Turkey cutlets are coated with our crispy coating mix and then stuffed with salsa and cheese. This recipe puts roasted turkey in the weeknight supper spotlight. shake n bakekraft canadamexicanturkeyrolls https://www.kraftheinz.com/en-CA/certo/recipes/531622-cooked-strawberry-jam-certo-liquid Cooked Strawberry Jam - CERTO Liquid | Certo | Canada | Recipes - Kraft Heinz Savour the flavour of summer with a batch of our delicious strawberry jam. Just follow our simple steps - you'll be amazed how easy it is to make homemade jam! strawberry jamcanada recipescookedcertoliquid https://www.kraftheinz.com/en-CA/kraft-miracle-whip/recipes/527952-miracle-whip-italian-chicken MIRACLE WHIP Italian Chicken | Kraft Miracle Whip | Canada | Recipes - Kraft Heinz Our 3-ingredient marinade takes baked chicken to another level. MIRACLE WHIP, Parmesan and Italian seasoning ensure your oven-baked chicken breasts are moist... miracle whipitalian chickenkraft canadarecipesheinz https://www.lindt.ca/en/ Chocolates, Truffles, Delicious Gifts, and Recipes from Lindt Canada Discover the world of chocolate with Lindt Canada. Shop online for our entire range of chocolates, plus find chocolates recipes, decor, tips and more. and recipeschocolatestrufflesdeliciousgifts https://www.weightwatchers.com/ca/en/recipe/farro-salad-with-tomatoes-and-balsamic-vinegar/562606f762ef001434bdf496 Farro salad with tomatoes and balsamic vinegar | Recipes | WW Canada (English) farro saladbalsamic vinegartomatoes https://www.weightwatchers.com/ca/en/recipe/slow-cooker-minestrone/562606de62ef001434bde553 Slow Cooker Minestrone | Recipes | WW Canada (English) slow cookerminestronerecipeswwcanada https://www.weightwatchers.com/ca/en/recipe/mini-brownie-cupcakes/5ebb0cb8c93e1a0e16f12020 Mini Brownie Cupcakes | Recipes | WW Canada (English) mini browniecupcakes recipeswwcanadaenglish https://www.weightwatchers.com/ca/en/recipe/chunky-strawberry-rhubarb-sauce/641397b0e2822660a7c96356 Chunky strawberry-rhubarb sauce | Recipes | WW Canada (English) strawberry rhubarbsauce recipeschunkywwcanada https://www.weightwatchers.com/ca/en/recipe/pork-medallions-indian-spiced-squash-saute/5f21ba5a69e77d033a27be77 Pork medallions with Indian-spiced squash saute | Recipes | WW Canada (English) pork medallionswith indianspiced https://www.weightwatchers.com/ca/en/recipe/ricotta-and-spinach-stuffed-cabbage/5e4474b374bee8002bc35673 Ricotta-and-spinach stuffed cabbage | Recipes | WW Canada (English) stuffed cabbagericottaspinachrecipesww https://www.weightwatchers.com/ca/en/recipe/orange-thyme-roasted-brussels-sprouts-and-sweet-potato/562606ca6dbe4a123407febb Orange-Thyme Roasted Brussels Sprouts and Sweet Potato | Recipes | WW Canada (English) roasted brussels sproutssweet potato recipes https://www.weightwatchers.com/ca/en/recipe/sweet-sour-dipping-sauce/645e9cf04df0093210b189e9 Sweet & sour dipping sauce | Recipes | WW Canada (English) sweet sourdipping saucerecipeswwcanada https://www.weightwatchers.com/ca/en/recipe/diy-microwave-popcorn/5db85c2066e96f0081c8d05e DIY Microwave Popcorn | Recipes | WW Canada (English) microwave popcorndiyrecipeswwcanada https://www.weightwatchers.com/ca/en/recipe/oat-and-farro-porridge-dates-and-coconut/62fe9e32ad49cc14d988bc3a Oat and Farro Porridge with Dates and Coconut | Recipes | WW Canada (English) coconut recipesoatfarroporridge https://www.weightwatchers.com/ca/en/recipe/french-lentil-salad-with-cranberries-and-feta/562606c26dbe4a123407fa37 French Lentil Salad with Cranberries and Feta | Recipes | WW Canada (English) lentil saladand fetafrenchcranberries https://www.weightwatchers.com/ca/en/recipe/mango-pudding/6012ffdfb4a3b673f4284996 Mango Pudding | Recipes | WW Canada (English) mango puddingrecipeswwcanadaenglish https://www.weightwatchers.com/ca/en/recipe/creamy-coleslaw/5626060f62ef001434bd6061 Creamy Coleslaw | Recipes | WW Canada (English) creamy coleslawrecipeswwcanadaenglish https://www.weightwatchers.com/ca/en/recipe/penne-roasted-cauliflower-feta/6569ec3b28ab553a3b199a0d Penne with roasted cauliflower & feta | Recipes | WW Canada (English) roasted cauliflowerfeta recipespennewwcanada https://www.weightwatchers.com/ca/en/recipe/baked-avocado-egg/59edfb2f830ae24408285ed8 Baked Avocado Egg | Recipes | WW Canada (English) egg recipesbakedavocadowwcanada https://www.weightwatchers.com/ca/en/recipe/grain-bowl-roasted-veggies-chicken-turmeric-yogurt/62fd594733e5e40c8af771d9 Grain bowl with roasted veggies, chicken & turmeric-yogurt | Recipes | WW Canada (English) roasted veggies https://www.weightwatchers.com/ca/en/recipe/mexican-style-brown-rice-casserole/5626067a6dbe4a123407d013 Mexican-Style Brown Rice Casserole | Recipes | WW Canada (English) brown rice casserolemexican stylerecipeswwcanada https://www.weightwatchers.com/ca/en/recipe/coffee-protein-smoothie/660aaf39fc640da98cd291d1 Coffee protein smoothie | Recipes | WW Canada (English) coffee proteinsmoothie recipeswwcanadaenglish https://www.weightwatchers.com/ca/en/recipe/roasted-eggplant-basil-spread/562605d762ef001434bd3f03 Roasted eggplant basil spread | Recipes | WW Canada (English) spread recipesroastedeggplantbasilww https://www.weightwatchers.com/ca/en/recipe/chicken-meatballs-turmeric-broth/60e8825c673fdd2ecb8519bd Chicken Meatballs in Turmeric Broth | Recipes | WW Canada (English) chicken meatballsbroth recipesturmericwwcanada https://www.weightwatchers.com/ca/en/recipe/french-lentil-bowl-creamy-mustard-vinaigrette/5c8822d258001c0010c8fdb6 French Lentil Bowl with Creamy Mustard Vinaigrette | Recipes | WW Canada (English) frenchlentilbowlcreamy https://www.weightwatchers.com/ca/en/recipe/sweet-and-spicy-crisps/562605ef6dbe4a1234077e02 Sweet-and-Spicy Crisps | Recipes | WW Canada (English) sweet and spicycrispsrecipeswwcanada https://www.weightwatchers.com/ca/en/recipe/peanut-ginger-sauce/5e8bad7b70a150002b150b1c Peanut-ginger sauce | Recipes | WW Canada (English) ginger saucepeanutrecipeswwcanada https://www.weightwatchers.com/ca/en/recipe/pineapple-rhubarb-crumble/605511e25460e927d4526cfd Pineapple-rhubarb crumble | Recipes | WW Canada (English) rhubarb crumblepineapplerecipeswwcanada https://www.weightwatchers.com/ca/en/recipe/farro-and-beet-salad-with-fennel-and-feta/5db7472f4164f8008151f0ef Farro and beet salad with fennel and feta | Recipes | WW Canada (English) farro and beet saladfeta recipes https://www.weightwatchers.com/ca/en/recipe/curried-carrot-slaw/64139bcd01d93a73ca9db003 Curried carrot slaw | Recipes | WW Canada (English) carrot slawcurriedrecipeswwcanada https://www.weightwatchers.com/ca/en/recipe/open-faced-spicy-tuna-melt/64c45a85750c773705233352 Open-faced spicy tuna melt | Recipes | WW Canada (English) open facedspicy tunameltrecipesww https://www.weightwatchers.com/ca/en/recipe/california-roll-sushi-bowl/62c0a10a0756d24fcaaf772f California Roll Sushi Bowl | Recipes | WW Canada (English) california rollsushi bowlrecipeswwcanada https://www.weightwatchers.com/ca/en/recipe/ginger-brussels-sprouts-with-pancetta-stir-fry/5b8ec683a468b70c4d59bc9b Ginger Brussels Sprouts with Pancetta Stir-Fry | Recipes | WW Canada (English) stir fry recipesbrussels sproutsgingerpancetta https://www.weightwatchers.com/ca/en/recipe/pomegranate-glazed-chicken/62c33a9be52ba2632e73f570 Pomegranate-Glazed Chicken | Recipes | WW Canada (English) glazed chickenpomegranaterecipeswwcanada https://www.weightwatchers.com/ca/en/recipe/chicago-style-hot-dogs/562606f66dbe4a1234081894 Chicago-style hot dogs | Recipes | WW Canada (English) chicago style hot dogsrecipeswwcanadaenglish https://www.weightwatchers.com/ca/en/recipe/tuscan-kale-and-white-bean-soup/59ee1deacae23b2dc51f5345 Tuscan Kale and White Bean Soup | Recipes | WW Canada (English) white bean souptuscan kalerecipeswwcanada https://www.weightwatchers.com/ca/en/recipe/grilled-bananas-with-cinnamon-and-chocolate/596e48fdbabc1ba648e51588 Grilled bananas with cinnamon and chocolate | Recipes | WW Canada (English) grilled bananasand chocolatecinnamonrecipesww https://www.weightwatchers.com/ca/en/recipe/banana-ice-cream-sandwiches/5b2bb98bbc557608ca838b4f Banana Ice Cream Sandwiches | Recipes | WW Canada (English) banana ice creamsandwichesrecipeswwcanada https://www.weightwatchers.com/ca/en/recipe/cinnamon-pecan-quick-bread/5eb07c3450f0e9057bb19ddb Cinnamon pecan quick bread | Recipes | WW Canada (English) quick bread recipescinnamonpecanwwcanada https://www.weightwatchers.com/ca/en/recipe/roasted-red-pepper-and-arugula-pinwheels/5626060d62ef001434bd5fa1 Roasted Red Pepper and Arugula Pinwheels | Recipes | WW Canada (English) roasted red pepperarugulapinwheelsrecipesww https://www.weightwatchers.com/ca/en/recipe/veggie-packed-fried-rice-shrimp/63603f839dac14092b7e2beb Veggie-packed fried rice with shrimp | Recipes | WW Canada (English) fried riceshrimp recipesveggiepackedww https://www.weightwatchers.com/ca/en/recipe/creamy-polenta-mushroom-bowls/61707bbe71e66c0e91081cdd Creamy Polenta & Mushroom Bowls | Recipes | WW Canada (English) creamy polentamushroombowlsrecipesww