https://californiawalnuts.ca/
California Walnuts Canada | Recipes, Nutrition & Plant-Based Goodness
May 20, 2026 - Discover California Walnuts — a versatile, plant-based source of omega-3 ALA. Explore recipes, nutrition facts, and ideas to power up every meal.
california walnutscanada recipesplant basednutritiongoodness
https://noixdegrenoble.ca/
California Walnuts Canada | Recipes, Nutrition & Plant-Based Goodness
May 20, 2026 - Discover California Walnuts — a versatile, plant-based source of omega-3 ALA. Explore recipes, nutrition facts, and ideas to power up every meal.
california walnutscanada recipesplant basednutritiongoodness
https://www.kraftheinz.com/en-CA/maxwell-house/recipes/574829-awake-peanut-butter-snack-bites
Awake Peanut Butter Snack Bites | Maxwell House | Canada | Recipes - Kraft Heinz
Try our super easy and super yummy recipe for Awake Peanut Butter Snack Bites. Ground coffee and chunks of white and semi-sweet chocolate create a wonderful...
peanut buttermaxwell housecanada recipesawakesnack
https://www.kraftheinz.com/en-CA/kraft-miracle-whip/recipes/532933-miracle-whip-make-ahead-buffet-salad
MIRACLE WHIP Make-ahead Buffet Salad | Kraft Miracle Whip | Canada | Recipes - Kraft Heinz
This layered salad recipe is a classic: The layers of crisp greens, bite-size veggies, grated cheese, crumbled bacon and creamy dressing combine for a...
miracle whipmake aheadkraft canadabuffetsalad
https://www.kraftheinz.com/en-CA/philadelphia/recipes/552561-philadelphia-new-york-style-sour-cream-topped-cheesecake
PHILADELPHIA New York-Style Sour Cream-Topped Cheesecake | Philadelphia | Canada | Recipes - Kraft...
This traditional sour cream cheesecake is always a favourite among our readers. Its richness is balanced by a ripe strawberry fruit topping. Now made in a...
philadelphia new yorksour creamcanada recipesstyle
https://www.kraftheinz.com/en-CA/kool-aid/recipes/500057-pastel-angel-cake
Pastel Angel Cake | KOOL-AID | Canada | Recipes - Kraft Heinz
Angel food cake gets a colourful twist in this sweet and simple dessert. With the addition of cherry KOOL-AID, a boxed angel food cake mix goes from classic to...
angel cakekool aidcanada recipespastelkraft
https://www.kraftheinz.com/en-CA/philadelphia/recipes/536748-philly-3-step-oreo-cheesecake
PHILLY 3-Step OREO Cheesecake | Philadelphia | Canada | Recipes - Kraft Heinz
Everybody's favourite cheesecake just got a whole lot easier to make at home! Follow our 3 simple steps to OREO Cheesecake greatness.
oreo cheesecakecanada recipesphilly3step
https://www.kraftheinz.com/en-CA/kraft-cool-whip/recipes/566601-pistachio-layered-dessert
Pistachio Layered Dessert | Kraft Cool Whip | Canada | Recipes - Kraft Heinz
Pistachio Layered Dessert
layered dessertcool whipcanada recipespistachiokraft
https://www.kraftheinz.com/en-CA/renees/recipes/577840-asian-chicken-rice-noodle-salad
Asian Chicken Rice Noodle Salad | RENEES | Canada | Recipes - Kraft Heinz
This is a super easy and a wonderfully tasty salad recipe.
chicken rice noodlecanada recipesasiansaladkraft
https://www.kraftheinz.com/en-CA/velveeta/recipes/550203-velveeta-buffalo-chicken-dip
VELVEETA Buffalo Chicken Dip | Velveeta | Canada | Recipes - Kraft Heinz
If you're the kind of person who likes to take home an empty dish after the potluck party, we recommend bringing this creamy Buffalo chicken dip.
buffalo chicken dipcanada recipesvelveetakraftheinz
https://www.kraftheinz.com/en-CA/maxwell-house/recipes/572723-creamy-coconut-tiramisu
Creamy Coconut Tiramisu | Maxwell House | Canada | Recipes - Kraft Heinz
Our Creamy Coconut Tiramisu has everything you love about classic tiramisu, with a tropical twist. Made with coconut milk and flaked coconut, this tiramisu...
creamy coconutmaxwell housecanada recipestiramisukraft
https://www.kraftheinz.com/en-CA/kraft-salad-dressing/recipes/584465-country-chicken-pie
Country Chicken Pie | Kraft Salad Dressing | Canada | Recipes - Kraft Heinz
Move over chicken pot pie! This twist has a deliciously cheesy, saucy chicken filling nestled between, not one, but two flaky crusts. This hearty chicken pie...
country chickensalad dressingcanada recipespiekraft
https://www.kraftheinz.com/en-CA/maxwell-house/recipes/548993-vanilla-chai-coffee-cooler
Vanilla Chai-Coffee Cooler | Maxwell House | Canada | Recipes - Kraft Heinz
This beverage is a coffee-shop fave that you can make at home. Chill out with our Vanilla Chai-Coffee Cooler - perfect for a mid-day break.
vanilla chaicoffee coolermaxwell housecanada recipeskraft
https://www.kraftheinz.com/en-CA/maxwell-house/recipes/503535-harvest-coffee-cider
Harvest Coffee Cider | Maxwell House | Canada | Recipes - Kraft Heinz
Flavoured with coffee and cinnamon, this hot cider is a twist on a traditional fall beverage.
harvest coffeemaxwell housecanada recipesciderkraft
https://www.kraftheinz.com/en-CA/kraft-shake-n-bake/recipes/536820-shake-n-bake-alongs
SHAKE'N BAKE Alongs | Kraft Shake n Bake | Canada | Recipes - Kraft Heinz
Greet them with the classic smell of oven baked chicken.
shake n bakekraft canadaalongsrecipesheinz
https://www.kraftheinz.com/en-CA/philadelphia/recipes/556448-creamy-lemon-squares
Creamy Lemon Squares | Philadelphia | Canada | Recipes - Kraft Heinz
These lemon squares are a creamy twist of the classic recipe that you have to taste to believe.
lemon squarescanada recipescreamyphiladelphiakraft
https://www.kraftheinz.com/en-CA/jell-o/recipes/503104-chocolate-bunny-cake
Chocolate Bunny Cake | Jell-O | Canada | Recipes - Kraft Heinz
Every bunny likes bunny cake! Especially when said bunny is made from a blend of chocolate cake mix and pudding, and topped with coconut and marshmallows.
chocolate bunnycanada recipescakejellkraft
https://www.kraftheinz.com/en-CA/certo/recipes/557326-cooked-apricot-jam-certo-crystals
Cooked Apricot Jam - CERTO Crystals | Certo | Canada | Recipes - Kraft Heinz
Just three simple ingredients - fresh apricots, sugar and CERTO Pectin Crystals - are needed to prepare this easy-to-make cooked jam recipe. Buy apricots when...
apricot jamcanada recipescookedcertocrystals
https://www.kraftheinz.com/en-CA/classico/recipes/583093-pumpkin-lasagna
Pumpkin Lasagna | Classico | Canada | Recipes - Kraft Heinz
Our Pumpkin Lasagna recipe is sure to become a new fall favourite. This Pumpkin Lasagna brings together pumpkin, creamy Alfredo sauce and cheesy noodles in an...
canada recipespumpkinlasagnaclassicokraft
https://www.kraftheinz.com/en-CA/velveeta/recipes/4SKoQ6Q9Yvq5wHzLF1s12V-cheesy-shells-with-tomatoes-and-corn
Cheesy Shells with Tomatoes and Corn | Velveeta | Canada | Recipes - Kraft Heinz
canada recipescheesyshellstomatoes
https://www.kraftheinz.com/en-CA/velveeta/recipes/502141-double-cheese-broccoli-soup
Double-Cheese Broccoli Soup | Velveeta | Canada | Recipes - Kraft Heinz
This broccoli soup is delicious, warm and guaranteed to make cold fingers toasty again, not to mention hearty and velvety with chopped broccoli and creamy...
double cheesebroccoli soupcanada recipesvelveetakraft
https://www.kraftheinz.com/en-CA/classico/recipes/548496-simply-lasagna
Simply Lasagna | Classico | Canada | Recipes - Kraft Heinz
Making lasagna has never been easier!
canada recipessimplylasagnaclassicokraft
https://www.kraftheinz.com/en-CA/certo/recipes/573606-cooked-raspberry-jam-certo-crystals
Cooked Raspberry Jam - CERTO Crystals | Certo | Canada | Recipes - Kraft Heinz
Combine fresh raspberries, sugar and CERTO Pectin Crystals to make this delicious ruby-red jam that your friends and family are sure to enjoy.
raspberry jamcanada recipescookedcertocrystals
https://www.kraftheinz.com/en-CA/kraft-salad-dressing/recipes/551742-russian-chicken-breasts
Russian Chicken Breasts | Kraft Salad Dressing | Canada | Recipes - Kraft Heinz
An elegant but easy chicken dish to prepare for entertaining.
chicken breastssalad dressingcanada recipesrussiankraft
https://www.kraftheinz.com/en-CA/kraft-cool-whip/recipes/578731-cool-whip-walnut-blondies
COOL WHIP Walnut Blondies | Kraft Cool Whip | Canada | Recipes - Kraft Heinz
Serve these COOL WHIP Walnut Blondies with a pot of hot coffee for a delectable homemade treat!
cool whipkraft canadawalnutblondiesrecipes
https://www.kraftheinz.com/en-CA/jet-puffed/recipes/524906-ghost-goo
Ghost Goo | Jet-Puffed | Canada | Recipes - Kraft Heinz
This is the only dessert dip you'll need for your Halloween party buffet! This creamy Ghost Goo is delicious with assorted fruit.
canada recipesghostgoojetpuffed
https://www.kraftheinz.com/en-CA/certo/recipes/557325-cooked-blueberry-jam-certo-crystals
Cooked Blueberry Jam - CERTO Crystals | Certo | Canada | Recipes - Kraft Heinz
Yes, even you can make jam! The CERTO Pectin Crystals are a quick and easy way to make homemade jams. This virtually foolproof recipe for Cooked Blueberry Jam...
blueberry jamcanada recipescookedcertocrystals
https://www.kraftheinz.com/en-CA/philadelphia/recipes/586451-everything-bagel-dip-with-veggies
Everything Bagel Dip with Veggies | Philadelphia | Canada | Recipes - Kraft Heinz
Everything bagel seasoning is not just for bagels anymore. This flavourful seasoning blend can be sprinkled over, or added to, a variety of foods. Add it to a...
everything bagelcanada recipesdipveggiesphiladelphia
https://www.kraftheinz.com/en-CA/certo/recipes/532361-red-currant-jelly
Red Currant Jelly | Certo | Canada | Recipes - Kraft Heinz
Transform a crop of fresh red currants into gleaming jars of Red Currant Jelly. Follow our simple steps to homemade jam - you'll wonder why you didn't try it...
red currantcanada recipesjellycertokraft
https://www.kraftheinz.com/en-CA/kraft-salad-dressing/recipes/585941-loaded-baked-potato-skins-casserole
Loaded Baked Potato Skins Casserole | Kraft Salad Dressing | Canada | Recipes - Kraft Heinz
A flavourful, comforting casserole prepared with potatoes jazzed up with ranch dressing, sour cream, shredded cheese and crisply cooked bacon. This is the dish...
loaded baked potatosalad dressingcanada recipesskinscasserole
https://www.kraftheinz.com/en-CA/philadelphia/recipes/585925-one-pot-creamy-chicken-tuscan-pasta
One-Pot Creamy Chicken Tuscan Pasta | Philadelphia | Canada | Recipes - Kraft Heinz
Get dinner done fast with our One-Pot Creamy Chicken Tuscan Pasta. This chicken Tuscan pasta is made of pantry staples, so it's a one-pot wonder!
one potcreamy chickencanada recipestuscan
https://www.kraftheinz.com/en-CA/taco-bell/recipes/2QdzbkO2lc2okP28KECQnb-cheesy-fiesta-nachos
Cheesy Fiesta Nachos | TACO BELL | Canada | Recipes - Kraft Heinz
taco bellcanada recipescheesyfiestanachos
https://www.kraftheinz.com/en-CA/jell-o/recipes/535883-creamy-jell-o-layers
Creamy JELL-O Layers | Jell-O | Canada | Recipes - Kraft Heinz
Whip up a fun and fruity dessert in minutes with just 2 ingredients - JELL-O and COOL WHIP are the shortcuts in this simple layered dessert recipe.
jell ocanada recipescreamylayerskraft
https://www.kraftheinz.com/en-CA/kraft-stove-top/recipes/545058-bruschetta-chicken-bake
Bruschetta Chicken Bake | Kraft Stove Top | Canada | Recipes - Kraft Heinz
bruschetta chicken bakestove topcanada recipeskraftheinz
https://www.kraftheinz.com/en-CA/certo/recipes/529337-certo-saskatoon-jelly
CERTO Saskatoon Jelly | Certo | Canada | Recipes - Kraft Heinz
Our Saskatoon berry jelly is a delightfully sweet Canadian treat. Made with fresh Saskatoon berries, lemon juice, sugar and pectin, this homemade jelly is a...
canada recipescertosaskatoonjellykraft
https://www.kraftheinz.com/en-CA/kraft-salad-dressing/recipes/585927-taco-pinwheels
Taco Pinwheels | Kraft Salad Dressing | Canada | Recipes - Kraft Heinz
In need of an easy and cheesy appetizer? Try these Taco Pinwheels. These delicious appetizers are guaranteed to win rave reviews from friends and family alike....
salad dressingcanada recipestacopinwheelskraft
https://www.kraftheinz.com/en-CA/kraft-shake-n-bake/recipes/526430-shake-n-bake-mexican-turkey-rolls
SHAKE'N BAKE Mexican Turkey Rolls | Kraft Shake n Bake | Canada | Recipes - Kraft Heinz
Turkey cutlets are coated with our crispy coating mix and then stuffed with salsa and cheese. This recipe puts roasted turkey in the weeknight supper spotlight.
shake n bakekraft canadamexicanturkeyrolls
https://www.kraftheinz.com/en-CA/certo/recipes/531622-cooked-strawberry-jam-certo-liquid
Cooked Strawberry Jam - CERTO Liquid | Certo | Canada | Recipes - Kraft Heinz
Savour the flavour of summer with a batch of our delicious strawberry jam. Just follow our simple steps - you'll be amazed how easy it is to make homemade jam!
strawberry jamcanada recipescookedcertoliquid
https://www.kraftheinz.com/en-CA/kraft-miracle-whip/recipes/527952-miracle-whip-italian-chicken
MIRACLE WHIP Italian Chicken | Kraft Miracle Whip | Canada | Recipes - Kraft Heinz
Our 3-ingredient marinade takes baked chicken to another level. MIRACLE WHIP, Parmesan and Italian seasoning ensure your oven-baked chicken breasts are moist...
miracle whipitalian chickenkraft canadarecipesheinz
https://www.lindt.ca/en/
Chocolates, Truffles, Delicious Gifts, and Recipes from Lindt Canada
Discover the world of chocolate with Lindt Canada. Shop online for our entire range of chocolates, plus find chocolates recipes, decor, tips and more.
and recipeschocolatestrufflesdeliciousgifts
https://www.weightwatchers.com/ca/en/recipe/farro-salad-with-tomatoes-and-balsamic-vinegar/562606f762ef001434bdf496
Farro salad with tomatoes and balsamic vinegar | Recipes | WW Canada (English)
farro saladbalsamic vinegartomatoes
https://www.weightwatchers.com/ca/en/recipe/slow-cooker-minestrone/562606de62ef001434bde553
Slow Cooker Minestrone | Recipes | WW Canada (English)
slow cookerminestronerecipeswwcanada
https://www.weightwatchers.com/ca/en/recipe/mini-brownie-cupcakes/5ebb0cb8c93e1a0e16f12020
Mini Brownie Cupcakes | Recipes | WW Canada (English)
mini browniecupcakes recipeswwcanadaenglish
https://www.weightwatchers.com/ca/en/recipe/chunky-strawberry-rhubarb-sauce/641397b0e2822660a7c96356
Chunky strawberry-rhubarb sauce | Recipes | WW Canada (English)
strawberry rhubarbsauce recipeschunkywwcanada
https://www.weightwatchers.com/ca/en/recipe/pork-medallions-indian-spiced-squash-saute/5f21ba5a69e77d033a27be77
Pork medallions with Indian-spiced squash saute | Recipes | WW Canada (English)
pork medallionswith indianspiced
https://www.weightwatchers.com/ca/en/recipe/ricotta-and-spinach-stuffed-cabbage/5e4474b374bee8002bc35673
Ricotta-and-spinach stuffed cabbage | Recipes | WW Canada (English)
stuffed cabbagericottaspinachrecipesww
https://www.weightwatchers.com/ca/en/recipe/orange-thyme-roasted-brussels-sprouts-and-sweet-potato/562606ca6dbe4a123407febb
Orange-Thyme Roasted Brussels Sprouts and Sweet Potato | Recipes | WW Canada (English)
roasted brussels sproutssweet potato recipes
https://www.weightwatchers.com/ca/en/recipe/sweet-sour-dipping-sauce/645e9cf04df0093210b189e9
Sweet & sour dipping sauce | Recipes | WW Canada (English)
sweet sourdipping saucerecipeswwcanada
https://www.weightwatchers.com/ca/en/recipe/diy-microwave-popcorn/5db85c2066e96f0081c8d05e
DIY Microwave Popcorn | Recipes | WW Canada (English)
microwave popcorndiyrecipeswwcanada
https://www.weightwatchers.com/ca/en/recipe/oat-and-farro-porridge-dates-and-coconut/62fe9e32ad49cc14d988bc3a
Oat and Farro Porridge with Dates and Coconut | Recipes | WW Canada (English)
coconut recipesoatfarroporridge
https://www.weightwatchers.com/ca/en/recipe/french-lentil-salad-with-cranberries-and-feta/562606c26dbe4a123407fa37
French Lentil Salad with Cranberries and Feta | Recipes | WW Canada (English)
lentil saladand fetafrenchcranberries
https://www.weightwatchers.com/ca/en/recipe/mango-pudding/6012ffdfb4a3b673f4284996
Mango Pudding | Recipes | WW Canada (English)
mango puddingrecipeswwcanadaenglish
https://www.weightwatchers.com/ca/en/recipe/creamy-coleslaw/5626060f62ef001434bd6061
Creamy Coleslaw | Recipes | WW Canada (English)
creamy coleslawrecipeswwcanadaenglish
https://www.weightwatchers.com/ca/en/recipe/penne-roasted-cauliflower-feta/6569ec3b28ab553a3b199a0d
Penne with roasted cauliflower & feta | Recipes | WW Canada (English)
roasted cauliflowerfeta recipespennewwcanada
https://www.weightwatchers.com/ca/en/recipe/baked-avocado-egg/59edfb2f830ae24408285ed8
Baked Avocado Egg | Recipes | WW Canada (English)
egg recipesbakedavocadowwcanada
https://www.weightwatchers.com/ca/en/recipe/grain-bowl-roasted-veggies-chicken-turmeric-yogurt/62fd594733e5e40c8af771d9
Grain bowl with roasted veggies, chicken & turmeric-yogurt | Recipes | WW Canada (English)
roasted veggies
https://www.weightwatchers.com/ca/en/recipe/mexican-style-brown-rice-casserole/5626067a6dbe4a123407d013
Mexican-Style Brown Rice Casserole | Recipes | WW Canada (English)
brown rice casserolemexican stylerecipeswwcanada
https://www.weightwatchers.com/ca/en/recipe/coffee-protein-smoothie/660aaf39fc640da98cd291d1
Coffee protein smoothie | Recipes | WW Canada (English)
coffee proteinsmoothie recipeswwcanadaenglish
https://www.weightwatchers.com/ca/en/recipe/roasted-eggplant-basil-spread/562605d762ef001434bd3f03
Roasted eggplant basil spread | Recipes | WW Canada (English)
spread recipesroastedeggplantbasilww
https://www.weightwatchers.com/ca/en/recipe/chicken-meatballs-turmeric-broth/60e8825c673fdd2ecb8519bd
Chicken Meatballs in Turmeric Broth | Recipes | WW Canada (English)
chicken meatballsbroth recipesturmericwwcanada
https://www.weightwatchers.com/ca/en/recipe/french-lentil-bowl-creamy-mustard-vinaigrette/5c8822d258001c0010c8fdb6
French Lentil Bowl with Creamy Mustard Vinaigrette | Recipes | WW Canada (English)
frenchlentilbowlcreamy
https://www.weightwatchers.com/ca/en/recipe/sweet-and-spicy-crisps/562605ef6dbe4a1234077e02
Sweet-and-Spicy Crisps | Recipes | WW Canada (English)
sweet and spicycrispsrecipeswwcanada
https://www.weightwatchers.com/ca/en/recipe/peanut-ginger-sauce/5e8bad7b70a150002b150b1c
Peanut-ginger sauce | Recipes | WW Canada (English)
ginger saucepeanutrecipeswwcanada
https://www.weightwatchers.com/ca/en/recipe/pineapple-rhubarb-crumble/605511e25460e927d4526cfd
Pineapple-rhubarb crumble | Recipes | WW Canada (English)
rhubarb crumblepineapplerecipeswwcanada
https://www.weightwatchers.com/ca/en/recipe/farro-and-beet-salad-with-fennel-and-feta/5db7472f4164f8008151f0ef
Farro and beet salad with fennel and feta | Recipes | WW Canada (English)
farro and beet saladfeta recipes
https://www.weightwatchers.com/ca/en/recipe/curried-carrot-slaw/64139bcd01d93a73ca9db003
Curried carrot slaw | Recipes | WW Canada (English)
carrot slawcurriedrecipeswwcanada
https://www.weightwatchers.com/ca/en/recipe/open-faced-spicy-tuna-melt/64c45a85750c773705233352
Open-faced spicy tuna melt | Recipes | WW Canada (English)
open facedspicy tunameltrecipesww
https://www.weightwatchers.com/ca/en/recipe/california-roll-sushi-bowl/62c0a10a0756d24fcaaf772f
California Roll Sushi Bowl | Recipes | WW Canada (English)
california rollsushi bowlrecipeswwcanada
https://www.weightwatchers.com/ca/en/recipe/ginger-brussels-sprouts-with-pancetta-stir-fry/5b8ec683a468b70c4d59bc9b
Ginger Brussels Sprouts with Pancetta Stir-Fry | Recipes | WW Canada (English)
stir fry recipesbrussels sproutsgingerpancetta
https://www.weightwatchers.com/ca/en/recipe/pomegranate-glazed-chicken/62c33a9be52ba2632e73f570
Pomegranate-Glazed Chicken | Recipes | WW Canada (English)
glazed chickenpomegranaterecipeswwcanada
https://www.weightwatchers.com/ca/en/recipe/chicago-style-hot-dogs/562606f66dbe4a1234081894
Chicago-style hot dogs | Recipes | WW Canada (English)
chicago style hot dogsrecipeswwcanadaenglish
https://www.weightwatchers.com/ca/en/recipe/tuscan-kale-and-white-bean-soup/59ee1deacae23b2dc51f5345
Tuscan Kale and White Bean Soup | Recipes | WW Canada (English)
white bean souptuscan kalerecipeswwcanada
https://www.weightwatchers.com/ca/en/recipe/grilled-bananas-with-cinnamon-and-chocolate/596e48fdbabc1ba648e51588
Grilled bananas with cinnamon and chocolate | Recipes | WW Canada (English)
grilled bananasand chocolatecinnamonrecipesww
https://www.weightwatchers.com/ca/en/recipe/banana-ice-cream-sandwiches/5b2bb98bbc557608ca838b4f
Banana Ice Cream Sandwiches | Recipes | WW Canada (English)
banana ice creamsandwichesrecipeswwcanada
https://www.weightwatchers.com/ca/en/recipe/cinnamon-pecan-quick-bread/5eb07c3450f0e9057bb19ddb
Cinnamon pecan quick bread | Recipes | WW Canada (English)
quick bread recipescinnamonpecanwwcanada
https://www.weightwatchers.com/ca/en/recipe/roasted-red-pepper-and-arugula-pinwheels/5626060d62ef001434bd5fa1
Roasted Red Pepper and Arugula Pinwheels | Recipes | WW Canada (English)
roasted red pepperarugulapinwheelsrecipesww
https://www.weightwatchers.com/ca/en/recipe/veggie-packed-fried-rice-shrimp/63603f839dac14092b7e2beb
Veggie-packed fried rice with shrimp | Recipes | WW Canada (English)
fried riceshrimp recipesveggiepackedww
https://www.weightwatchers.com/ca/en/recipe/creamy-polenta-mushroom-bowls/61707bbe71e66c0e91081cdd
Creamy Polenta & Mushroom Bowls | Recipes | WW Canada (English)
creamy polentamushroombowlsrecipesww