Robuta

https://heartcentrekcrmh.com/ Heart Centre Ranchi – Cardiology Hospital in Ranchi, Jharkhand backed by Jharkhand's Best Cardiac... https://www.cfrjournal.com/ Cardiac Failure Review (CFR) | CFR Journal | Radcliffe Cardiology Cardiac Failure Review (CFR) is a Tri-Annual journal aimed at assisting heart failure specialists and cardiologists to stay abreast of key advances and opinion... cardiac failure reviewcfrjournalradcliffecardiology https://www.heart.org/en/about-us/heart-attack-and-stroke-symptoms Heart Attack, Stroke and Cardiac Arrest Symptoms | American Heart Association Heart Attack, Stroke and Cardiac Arrest Symptoms heart attackcardiac arreststrokesymptomsamerican https://www.sonusmicrosystems.com/ Sonus Microsystems | wearable cardiac ultrasound imaging Sonus Microsystems is developing the first wearable cardiac ultrasound patch for congestive heart failure using unique polymer ultrasound transducers. cardiac ultrasoundsonusmicrosystemswearableimaging https://citoday.com/ Cardiac Interventions Today News and information on minimally invasive coronary disease therapies, covering valvular, structural, radial access, chronic total occlusion, and imaging... cardiacinterventionstoday https://tricog.com/ Accelerating Cardiac Care Diagnosis | Tricog Health Jul 17, 2026 - Ensuring accurate and timely accelerating cardiac care for patients is a top priority. Discover how this Human + AI-based platform can help you achieve goal. cardiac careacceleratingdiagnosishealth https://opencarp.org/ Cardiac Electrophysiology Simulator | openCARP Cardiac Electrophysiology Simulator cardiac electrophysiologysimulatoropencarp https://dgk.org/ Deutsche Gesellschaft für Kardiologie – Herz- und Kreislaufforschung e.V. – German Cardiac Society https://cardiac-stemcell-therapy.com/ Cardiac-Stemcell-Therapy.com - A Premium Health Domain Cardiac-stemcell-therapy.com is listed and offered for acquisition. Inquire about this unique health domain today. a premiumcardiacstemcelltherapyhealth https://www.cardiac-diagnostics.com/ News — School of Cardiac Diagnostics School of Cardiac Diagnostics — News — To really understand the Heart school ofnewscardiacdiagnostics https://www.ccardiac.com/ Cardiac Services and Sleep Care in Annapolis, MD | Chesapeake Cardiac Care Aug 23, 2018 - Cardiac Services and Sleep Care in Annapolis, MD - Visit our skilled Cardiac Services and Sleep Care in Annapolis, MD. Accepting new appointments. Call today... cardiac servicessleep careannapolis mdchesapeake https://cardiooneconnect.com/ Remote Cardiac Monitoring & Care Management | CardioOne Connect Jun 25, 2026 - Streamline your practice with CardioOne Connect. We provide turnkey ambulatory cardiac diagnostics, RPM, and chronic care management to extend clinical care... cardiac monitoringcare managementremoteconnect https://hytestna.com/home Antibody Manufacturing and Cardiac Marker Production | Hytest North America HyTest offers innovative solutions for assay development and research applications by providing high-quality immunological reagents in such areas as cardiac... antibody manufacturingcardiac markerproductionhytestnorth https://tx-cares.com/ TX-CARES | Texas Cardiac Arrest Registry to Enhance Survival Texas Cardiac Arrest Registry to Enhance Survival cardiac arresttxcarestexasregistry https://www.cardiostat.com/ Ambulatory cardiac monitoring simplified | CardioSTAT ambulatory cardiac monitoringsimplifiedcardiostat https://scst.org.uk/ SCST | The Society for Cardiac Science and Technology (SCST) the societycardiac sciencescsttechnology https://ecsclub.org/ Endoscopic Cardiac Surgeons Club | cardiac surgeonsendoscopicclub https://www.emmastery.com/cardiac-bootcamp-self-study-course Cardiac Bootcamp cardiacbootcamp https://3cpr.org/ Home - Colorado Cardiac CPR & First Aid Colorado Cardiac CPR Colorado Cardiac CPR is one of Colorado’s top-rated CPR, First Aid and Basic Life Support Training Centers. For nearly a decade our team... coloradocardiaccprfirstaid https://emt-classes-of-ri.com/ EMT, AEMT-Cardiac, CNA, Phelbotomy, EKG Tech Course, online hybrid EMT classes education and... EMT programs school training courses classes in RI. EMT programs school training in RI morning evening night classes, AEMT-C (Cardiac) school course class... https://cardiacwire.com/cathworks-ffrangio-goes-beyond-physiology/ CathWorks FFRangio Goes Beyond Physiology - Cardiac Wire Dec 12, 2025 - Despite society guidelines and extensive clinical evidence demonstrating that traditional wire-based coronary physiology improves outcomes and reduces costs... goesbeyondphysiologycardiacwire https://cardiacinstitute.bg/ Български Кардиологичен Институт – Bulgarian Cardiac Institute bulgariancardiacinstitute https://ourheartsight.com/ OurHeartsight | Understanding cardiac arrest understandingcardiacarrest https://cardiacrhythmnews.com/ Cardiac Rhythm News | Independent Source of News for Cardiac Rhythm Specialists Jul 9, 2026 - Keeping you updated with the Cardiac Rhythm specialist field, Cardiac Rhythm News is an editorially independent source of news and reviews. cardiac rhythm newsindependentsourcespecialists https://cvgcares.com/ Cardiologists Near Me in Gwinnett County: Heart (Cardiac) Doctors | Cardiology Specialists | CVG... Oct 15, 2025 - Find top Cardiologists in Gwinnett County at CVG Cares! Specialized heart doctors offering excellent cardiac (cardiovascular) care. Your heart health is our... near megwinnett county https://advancecardiaccare.com/ Advanced Cardiac Treatment | Advance Cardiac Care Mar 3, 2026 - Discover Advanced Cardiac Treatment at Advance Cardiac Care. Our expert team provides top-tier heart health solutions. advanced cardiactreatmentcare https://michigancr.org/ HOME PAGE - Michigan Cardiac Rehab Network home pagecardiac rehabmichigannetwork https://cardiacwire.com/ Home - Cardiac Wire May 12, 2025 - Subscribe to the Cardiac Wire – Get the twice-weekly newsletter that makes it easy to stay informed about cardiology. cardiacwire https://www.csanzasm.com/ CSANZ 2026 - 74th Annual Scientific Meeting of the Cardiac Society in Sydney, Australia - CSANZ 2026 The 74th Annual Scientific Meeting of the Cardiac Society of Australia and New Zealand. Held at Sydney International Convention Centre from 6 - 9 August 2025 annual scientific meeting https://nhearthospital.com/ Northern Heart Hospital Penang | Premier Cardiac & Vascular Care Apr 1, 2026 - Northern Heart Hospital, Penang's premier cardiac and vascular specialist, offering advanced care and accessible services for local and international patients. northern heart hospitalpenangpremiercardiacvascular https://cardiac-alliance.org/ Global Cardiac Alliance – The Global Cardiac Alliance is committed to bringing sustainable health... globalcardiacalliance https://screening.inaheartbeat.org/ Cardiac Screening Program Registration Cardiac Screening Program Registration cardiac screeningprogramregistration https://srmkpcardiac.com/ SR Mehta Hospital Mumbai | Best Cardiac Hospital in Mumbai srmehtahospitalmumbaibest https://www.cardiac-research.org/ Northwick Park Cardiac Research Charity Dec 10, 2024 - Working to improve our knowledge about heart disease to help save lives. Support cardiac research at Northwick Park Hospital. northwick parkcardiac researchcharity https://harmonicproject.eu/ Harmonic, pediatrics, radiotherapy, cardiac fluoroscopy Feb 10, 2020 - Harmonic is a European-funded project that aims at better understanding the long-term health effects of medical exposure to ioinising radiation in children... harmonicpediatricsradiotherapycardiacfluoroscopy https://keebohealth.com/ KeeboHealth HF - Connected Cardiac Care. Web site created using create-react-app keebohealthhfconnectedcardiaccare https://www.ciputracardiac.com/ Ciputra Cardiac Center - Klinik Jantung di Jakarta Barat Jul 14, 2026 - Klinik Jantung di Jakarta Barat, Ciputra Cardiac Center hadirkan layanan kardiologi komprehensif didukung oleh 9 konsultan subspesialis jantung cardiac centerklinik jantungciputrajakartabarat https://cardiacdimensions.com/ Cardiac Dimensions Apr 13, 2026 - Cardiac Dimensions is on a mission to bring more success to the treatment of heart failure patients. cardiacdimensions https://cardiac-imaging-wroclaw.pl/ Cardiac Imaging Wroclaw 2025 cardiac imagingwroclaw https://www.emcore.com.au/product-category/cardiac-bootcamp/ Cardiac Bootcamp Archives | EMCORE Join our Cardiac Bootcamp for top-notch cardiac care and recovery strategies. Expert advice, workouts, and diet tips to keep your heart healthy! cardiac bootcamparchivesemcore https://experts.umn.edu/en/publications/regional-systems-of-care-for-out-of-hospital-cardiac-arrest-a-pol/ Regional systems of care for out-of-hospital cardiac arrest: A policy statement from the american... https://boris-portal.unibe.ch/entities/publication/b31263eb-ab75-45e7-845a-6b6d59c7b620 Subsequent cardiac surgery after transcatheter aortic valve implantation: Indications and outcomes. BACKGROUND Aim of this study was to report on indications and clinical outcomes of patients who underwent subsequent open-cardiac surgery after transcatheter... cardiac surgeryaortic valvesubsequent https://hb.diva-portal.org/smash/record.jsf?pid=diva2:1687319 Trends in survival after cardiac arrest: a Swedish nationwide study over 30 years https://www.med.unc.edu/cellbiophysio/tag/cardiac/ cardiac Archives - Department of Cell Biology and Physiology department ofcell biologycardiacarchivesphysiology https://experts.arizona.edu/en/publications/cardiac-arrest-witnessed-by-emergency-medical-services-personnel-/ Cardiac arrest witnessed by emergency medical services personnel: Descriptive epidemiology,... emergency medical servicescardiac arrestwitnessedpersonneldescriptive https://www.techtransfer.nih.gov/patent/e-087-2002-0-ep-04 Methods For Preventing or Treating Cardiac Arrhythmia | Technology Transfer cardiac arrhythmiamethodspreventingtreatingtechnology https://archives.med.nyu.edu/node/8052 New York Post-Graduate Medical School and Hospital Cardiac Clinic | The Lillian & Clarence de la... https://boris-portal.unibe.ch/entities/publication/7124e61e-3a08-4746-b84b-17e40befa29f SWISSPAQ: validation of a new physical activity questionnaire in cardiac rehabilitation patients of aphysical activity https://med.uc.edu/depart/surgery/divisions/cardiothoracic-surgery Cardiac Surgery | Cardiothoracic Surgery | Divisions | Surgery | UC Medicine The Division of Cardiac Surgery leads the region in the discovery and advancement of innovative treatment for patients with cardiac disease. cardiac surgerycardiothoracicdivisionsucmedicine https://oceansidecardiology.com.au/ Oceanside Cardiology - Exceptional Cardiac Care Nov 2, 2025 - Led by renowned interventional cardiologist, Dr Peter J Larsen, we provide comprehensive heart care backed by state-of-the-art medical technology. oceansidecardiologyexceptionalcardiaccare https://pubmed.ncbi.nlm.nih.gov/9805946/ [Postoperative prognosis of congenital cardiac anomalies] Congenital cardiac anomalies cannot be merely classified as "less", "more", and "very" complex. However, postoperative prognosis is also determined by: the... postoperativeprognosiscongenitalcardiacanomalies https://ja.dh.duke.edu/pediatric-cardiac-cath-ep-fellow-education-conference-2021/content/pediatric-cardiac-cathep-fellow-education-conference-2021-45 Pediatric Cardiac CATH/EP Fellow Education Conference 2021 | DUKEHealth JA pediatric cardiacfellow educationcathepconference https://revistas.usp.br/rbefe/en/article/view/195223/191955 View of Effects of functional training on functional capacity of ischemic cardiac patients functional trainingvieweffectscapacityischemic https://cdrh-rst.fda.gov/parsimonious-cardiac-action-potential-model-rabbit Parsimonious Cardiac Action Potential Model of the Rabbit | Center for Devices and Radiological... https://pediatrics.ucsf.edu/node/301661 The combinatorial activities of Nkx2.5 and dHAND are essential for cardiac ventricle formation. |... https://boris-portal.unibe.ch/entities/publication/a39083a2-17ef-446e-9685-8a391e1ca886 Re: Cardiac denervation does/does not play a major role in exercise limitation after heart... https://www.justgiving.com/page/francesca-turner-1701697922865 Francesca Turner is fundraising for Cardiac Risk in the Young Help Francesca Turner raise money to support Cardiac Risk in the Young in thefrancescaturnerfundraisingcardiac https://iris.cnr.it/handle/20.500.14243/513333 Myopalladin knockout mice develop cardiac dilation and show a maladaptive response to mechanical... https://www2.heart.org/site/TR/HeartWalk/GSA-GreaterSoutheastAffiliate?pg=team&team_id=957441&fr_id=13200 2026 Sumter Clarendon Heart Walk: McLeod Clarendon Cardiac Rehab - Heart Walk - American Heart... heart walkcardiac rehabsumterclarendonmcleod https://scholars.duke.edu/publication/1369064 Scholars@Duke publication: Acoustic radiation force-based ultrasound elastography for cardiac... scholarsdukepublicationacousticradiation https://health.economictimes.indiatimes.com/news/diagnostics/e-cigarettes-can-cause-cardiac-arrhythmias-warns-new-research/95102587 E-cigarettes can cause cardiac arrhythmias, warns new research, ETHealthworld The findings of this study are important because they provide fresh evidence that the use of e-cigarettes could interfere with normal heart rhythms, something... e cigarettescan causenew researchcardiacarrhythmias https://aeddronestudy.web.unc.edu/2020/05/bystander-search-for-an-automatic-external-defibrillator-for-out-of-hospital-cardiac-arrest-with-and-without-directional-assistance/ Out-of-hospital cardiac arrest bystander defibrillator search time and experience with and without... out of hospital https://scholars.duke.edu/publication/1608786 Scholars@Duke publication: Addition by Subtraction in Mechanical Cardiac Support. addition by subtractionscholarsdukepublicationmechanical https://diwakaraditi30.wixsite.com/cardiac-help/copy-of-lobectomy-1 Lung Transplant | Cardiac Help lung transplantcardiachelp https://about.uq.edu.au/experts/project/43245 Using human pluripotent stem cells to achieve scalable, high purity production of cardiac cells for... https://www.researchandmarkets.com/reports/5646614/advances-in-physiologic-pacing-an-issue-of Advances in physiologic pacing, An Issue of Cardiac Electrophysiology Clinics. The Clinics:... Advances in physiologic pacing, An Issue of Cardiac Electrophysiology Clinics. The Clinics: Internal Medicine Volume 14-2 an issuecardiac electrophysiologyadvancespacing https://internalmedicine.medicine.uiowa.edu/internal-medicine-fellowship-programs/clinical-cardiac-electrophysiology-fellowship Clinical Cardiac Electrophysiology Fellowship | Department of Internal Medicine - Carver College of... The Clinical Cardiac Electrophysiology Fellowship Training Program develops and enhances skills in the technical/procedural aspects of clinical... cardiac electrophysiologydepartment ofinternal medicineclinicalfellowship https://my.clevelandclinic.org/health/diseases/22598-cardiac-amyloidosis Cardiac Amyloidosis: Symptoms & Treatment Cardiac amyloidosis is a condition where faulty proteins bunch together and accumulate in your heart. This condition is often treatable and sometimes curable. cardiac amyloidosissymptomstreatment https://pubmed.ncbi.nlm.nih.gov/41205856/ What to expect from a smartphone dispatch application for out-of-hospital cardiac arrest in a... The nationwide deployment of a smartphone dispatch application facilitated citizen response and CPR initiation before EMS arrival, highlighting the importance... https://ondemand.heart.org/p/s/new-frontiers-in-the-management-of-cardiac-dysautonomias-4018 New Frontiers in the Management of Cardiac Dysautonomias - AHA OnDemand Cardiac dysautonomias (AD) are commonly encountered. However, managing these complex syndromes has been challenging, with specific subsets, such as... new frontiersin themanagementcardiacaha https://www.andthebeatgoeson.co.uk/ and the beat goes on cardiac rehab | And The Beat Goes On, UK Online Discover and the beat goes on with And The Beat Goes On, UK-based cardiac rehab support and online resources to keep your recovery moving. and the beat goes oncardiac rehabukonline https://www.frontiersin.org/journals/bioengineering-and-biotechnology/articles/10.3389/fbioe.2024.1521462/full Frontiers | Amniotic membrane, a novel bioscaffold in cardiac diseases: from mechanism to... Cardiovascular diseases represent one of the leading causes of death worldwide. Despite significant advances in the diagnosis and treatment of these diseases... amniotic membrane https://experts.arizona.edu/en/publications/cardiac-troponin-i-is-a-heart-specific-marker-in-the-xenopus-embr/ Cardiac troponin I is a heart-specific marker in the Xenopus embryo: Expression during abnormal... https://researchdiscovery.drexel.edu/esploro/outputs/doctoral/Immunohistochemical-studies-of-limulus-cardiac-muscle/991021887684104721 Immunohistochemical studies of limulus cardiac muscle - Drexel University Immunohistochemical studies of limulus cardiac muscle - Drexel University - Dissertation cardiac muscleimmunohistochemicalstudieslimulusdrexel https://eprints.ncl.ac.uk/193796 Extracorporeal membrane oxygenation for resuscitation of deceased cardiac donor livers for... membraneoxygenationresuscitationdeceasedcardiac https://www.hridaymitracardiaclinic.com/ Best Cardiologist in Pune | Cardiac Clinic in Pune | Dr. Rahul Sawant Oct 15, 2025 - Dr. Rahul Sawant's Cardiac Clinic: The Best Cardiologist in Pune. Exceptional Heart Care at the Leading Cardiac Clinic in Pune. Top cardiologist providing... best cardiologistin punecardiac clinicdrrahul https://hsrd.research.va.gov/news/research_news/cardiac-022615.cfm HSR&D Study Finds Gender Differences Related to Cardiac Catheterization study findsgender differenceshsrrelatedcardiac https://pubmed.ncbi.nlm.nih.gov/18243656/ Left ventricle volume measurements in cardiac micro-CT: the impact of radiation dose and contrast... Micro-CT-based cardiac function estimation in small animals requires measurement of left ventricle (LV) volume at multiple time points during the cardiac... https://pure.psu.edu/en/publications/age-race-and-sex-differences-in-autonomic-cardiac-function-measur/ Age, race, and sex differences in autonomic cardiac function measured by spectral analysis of heart... https://pubmed.ncbi.nlm.nih.gov/28904070/ Antiarrhythmic Drugs for Nonshockable-Turned-Shockable Out-of-Hospital Cardiac Arrest: The ALPS... URL: https://www.clinicaltrials.gov. Unique identifier: NCT01401647. out of hospital https://eprints.ncl.ac.uk/99297 Six year outcomes using donors after cardiac death (DCD) kidneys (Maastricht categories II-IV) for... https://hartmaninstitute.weill.cornell.edu/xenopus-gata-456-genes-are-associated-cardiac-specification-and-can-regulate-cardiac-specific The Xenopus GATA-4/5/6 genes are associated with cardiac specification and can regulate... https://pure.psu.edu/en/publications/impact-of-chronic-alcohol-ingestion-on-cardiac-muscle-protein-exp/ Impact of chronic alcohol ingestion on cardiac muscle protein expression - Penn State https://letstalkiccprpodcast.buzzsprout.com/2418376/episodes/16354518-episode-2-advocacy-in-action-advancing-home-based-cardiac-care Episode 2. Advocacy in action: Advancing home-based cardiac care In this episode, Dr. Abraham Babu, ICCPR Vice-Chair, shares his passion for advocating cardiac rehabilitation in low-resource and low- to middle-income... advocacy in actionhome basedepisodeadvancingcardiac https://www.qk.sjtu.edu.cn/jdcp/EN/abstract/article/1671-2870/34424 Application of cardiac magnetic resonance feature-tracking in assessment of postoperative... magnetic resonancefeature trackingapplicationcardiacassessment https://www.provenexpert.com/en-us/cardiac-lifecare3/ Cardiac Lifecare Reviews & Experiences cardiaclifecarereviewsexperiences https://research.manchester.ac.uk/en/publications/tipping-points-in-cardiac-surgical-performance-the-application-of/ Tipping Points in Cardiac Surgical Performance: The Application of Dynamic Risk Prediction... tipping points https://refubium.fu-berlin.de/handle/fub188/44997 Refubium - High-Sensitivity Cardiac Troponin T and Cognitive Decline in Older Adults: Results of... https://profiles.nlm.nih.gov/spotlight/hp/catalog/nlm:nlmuid-101584933X14-doc The Current Status of Open Cardiac Surgery - Henry Swan - Profiles in Science the currentcardiac surgery https://procareers.diabetes.org/jobs/21400909/registered-nurse-operating-room-cardiac-12-hours-days-10-000-hiring-incentive Registered Nurse - Operating Room - Cardiac - 12 Hours Days - $10,000 Hiring Incentive in Los... Exciting opportunity in Los Angeles, CA for Cedars Sinai as a Registered Nurse - Operating Room - Cardiac - 12 Hours Days - $10,000 Hiring Incentive https://pure.psu.edu/en/publications/hypotension-after-cardiac-operations-based-on-autoregulation-moni/ Hypotension After Cardiac Operations Based on Autoregulation Monitoring Leads to Brain Cellular... based on https://www.cardiactesting.co.uk/ Cardiac Testing – Rapid Access Screening for International Patients The private echo service is run at an independent clinic and testing area away from the large hospital environment to improve patient experience and speed of... cardiac testingrapid accessfor internationalscreeningpatients https://pubmed.ncbi.nlm.nih.gov/24360157/ The obesity paradox in cardiac arrest patients Evidence from clinical cohorts indicates an obesity paradox in overweight and obese patients who seem to have a more favorable short-term and long-term... cardiac arrestobesityparadoxpatients https://pmc.ncbi.nlm.nih.gov/articles/PMC7749053/ Current Challenges in Cardiac Rehabilitation: Strategies to Overcome Social Factors and Attendance... Cardiac rehabilitation (CR) significantly reduces secondary cardiovascular events and mortality and is a class 1A recommendation by the American Heart... current challengescardiac rehabilitation https://sgrace.info.yorku.ca/tools-to-promote-cardiac-rehabilitation-utilization/ Tools to Promote Patient Utilization of Cardiac Rehabilitation (ie., enrolment, adherence,... cardiac rehabilitationtoolspromotepatientutilization https://chaste.github.io/releases/2026.1/user-guides/cardiac-mechanics-solvers/ Cardiac Mechanics Solvers Chaste Cardiac Mechanics Solvers cardiacmechanicssolverschaste https://scholarworks.indianapolis.iu.edu/items/671caaad-d0fc-4688-85a6-7fe20d2a9c53 Outcomes of Veno-Arterial Extracorporeal Membrane Oxygenation for In-Hospital Cardiac Arrest Veno-arterial extracorporeal membrane oxygenation (VA ECMO) is increasingly used in cardiac arrest. Currently, public registries report the outcomes of cardiac... https://pubmed.ncbi.nlm.nih.gov/4170370/ The operation. A human cardiac transplant: an interim report of a successful operation performed at... The operation. A human cardiac transplant: an interim report of a successful operation performed at Groote Schuur Hospital, Cape Town https://pair.upenn.edu/publication/covid-19-and-cardiac-arrhythmias/ COVID-19 and cardiac arrhythmias | The PAIR Center BACKGROUND: Early studies suggest that coronavirus disease 2019 (COVID-19) is associated with a high incidence of cardiac arrhythmias. Severe acute the paircovidcardiacarrhythmiascenter https://www.surrey.ac.uk/research-projects/what-brain-telling-heart-cardiac-electrophysiological-and-molecular-alterations-parkinsons-disease What the brain is telling the heart: Cardiac electrophysiological and molecular alterations in... what the