Robuta

https://www.raad360.com/ RAAD™ | Supply Chain Resilience | raad360.com Achieve intelligent resilience with the RAAD™ supply chain and value chain risk management software platform - create your own unique risk management... supply chain resilience https://www.epicor.com/en/solutions/technology/supply-chain-resilience/ Supply Chain Resilience | Epicor Supply chain disruption is a question of when, not if. Adapt fast to changing conditions to maximize uptime and profitability. supply chain resilienceepicor https://www.avetta.com/blog/how-telecom-companies-can-build-supply-chain-resilience How Telecom Companies Can Build Supply Chain Resilience | Avetta Avetta empowers telecom companies to navigate supply chain challenges and build resilience with our Supply Chain Resilience for Telecom solutions. supply chain resiliencetelecomcompaniesbuildavetta https://www.digital-bb.de/newsdetail/supply-chain-resilience-platform-matchmaking-zum-aufbau-neuer-lieferketten Supply Chain Resilience Platform: Matchmaking zum Aufbau neuer Lieferketten | Cluster IKT Die europäische Plattform zum Aufbau neuer Lieferketten supply chain resiliencezum aufbauplatformmatchmakingneuer https://www.dezshira.com/events/details/2026-asian-manufacturing-outlook-navigating-supply-chain-resilience-for-fies.html 2026 Asian Manufacturing Outlook: Navigating Supply Chain Resilience for FIEs | Dezan Shira &... supply chain resiliencemanufacturing outlookasiannavigatingfies https://www.nitra.com/resources/supply-chain-resilience-the-role-of-online-medical-supplies-marketplaces Supply Chain Resilience: The Role of Online Medical Supplies Marketplaces supply chain resilienceonline medicalrolesuppliesmarketplaces https://rethinktrade.org/hyperglobalization-supply-chains/ Hyperglobalization vs. Supply Chain Resilience | Rethink Trade Nov 26, 2025 - A look at how hyperglobalization and the de minimis loophole weakened U.S. supply chains, and why resilience requires more domestic production supply chain resiliencevsrethinktrade https://www.koaloo-fi.com/ Koaloo.Fi | Boost Your Supply Chain Resilience and Profits Boost your supply chain's resilience and profits with Koaloo.Fi's AI-driven solutions. supply chain resiliencefiboost https://wiot-group.com/think/en/news/connected-load-carrier-how-digital-assets-empower-supply-cha/ How Digital Assets Boost Supply Chain Resilience | Connected Load Carrier May 6, 2026 - Discover how digital twins of physical load carriers enhance supply chain efficiency and reduce errors at handovers. supply chain resiliencedigital assetsboostconnectedload https://www.clariumhealth.com/ AI-Powered Supply Chain Resilience Platform | Clarium AI-Powered Supply Chain for Healthcare. Clarium’s supply chain resilience platform provides real-time visibility and intelligent automation to unlock... ai powered supplychain resilienceplatform https://www.thebci.org/training/supply-chain-resilience-2-day-training-course.html Supply Chain Resilience 2-Day Training Course | BCI supply chain resiliencetraining coursedaybci https://www.aspentech.com/en/industries/bulk-chemicals/?src=web-apaccn Circular Supply Chain Resilience & Decarbonization | Bulk Chemical Manufacturing | AspenTech AspenTech optimizes bulk chemical manufacturing plant operations to achieve performance, circular supply chain resilience, and decarbonization goals. supply chain resiliencechemical manufacturingcirculardecarbonizationbulk https://www.maersk.com/insights/resilience/2022/12/07/five-ways-to-build-supply-chain-resilience Five ways to build supply chain resilience in 2023 | Maersk Nov 21, 2024 - Worried about supply chain disruptions? Here’s how to improve supply chain resilience in five easy ways to get ready for what’s to come supply chain resiliencefive waysbuildmaersk https://www.aspentech.com/en/industries/bulk-chemicals?src=web-apaccn Circular Supply Chain Resilience & Decarbonization | Bulk Chemical Manufacturing | AspenTech AspenTech optimizes bulk chemical manufacturing plant operations to achieve performance, circular supply chain resilience, and decarbonization goals. supply chain resiliencechemical manufacturingcirculardecarbonizationbulk https://www.foodbusinessreview.com/leadership-perspective/maintaining-supply-chain-resilience-with-packaging-procurement-and-people-nwid-767.html Maintaining Supply Chain Resilience With Packaging, Procurement and... May 12, 2026 - It has happened to most of us over the past few years. You get a hankering for that one delicious food that only a particular restaurant makes just the way... supply chain resiliencemaintainingpackagingprocurement https://www.indiapharmaoutlook.com/industry-experts/enhancing-clinical-trial-supply-chain-resilience-to-address-global-disruptions-in-india-nwid-3154.html Enhancing Clinical Trial Supply Chain Resilience to Address Global Disruptions in India clinical trial supplychain resilienceenhancingaddressglobal https://www.gdit.com/perspectives/latest/securing-the-edge-driving-supply-chain-resilience-across-the-indo-pacific/ Securing the Edge: Driving Supply Chain Resilience Across the Indo-Pacific | GDIT GDIT’s Joe McMahon sat down with Colonel Todd Burroughs, Deputy Commanding Officer for Support, 7th Infantry Division Multi-Domain Command, Pacific, to discuss... supply chain resilienceindo pacificsecuringedgedriving https://supplychainresiliencehub.com/ Supply Chain Resilience Hub – Building Responsible and Resilient UK Manufacturing Supply Chains. supply chain resilienceuk manufacturinghubbuildingresponsible https://www.klim.eco/ Supply chain resilience through regenerative practices - Klim Klim partners with farms and companies to scale regenerative practices through Scope 3 projects, carbon credits, and innovative digital solutions. supply chain resilienceregenerativepracticesklim https://defensescoop.com/video/saps-joe-ditchett-on-supply-chain-resilience-for-modern-defense/ SAP’s Joe Ditchett on supply chain resilience for modern defense | DefenseScoop Dec 15, 2025 - Joe DItchett | Industry Executive Advisor | SAP supply chain resiliencejoemoderndefense https://www.pwc.in/case-studies/building-a-trustworthy-and-resilient-supply-chain.html Building A Resilient Supply Chain - Resilience In Supply Chain Learn how to build a trustworthy and resilient supply chain that can withstand disruptions with PwC India's supply chain transformation solutions. supply chain resiliencebuildingresilient https://www.themanufacturingoutlook.com/leadership-perspective/maintaining-supply-chain-resilience-with-packaging-procurement-and-people-nwid-1875.html Maintaining Supply Chain Resilience with Packaging, Procurement and... Mar 23, 2026 - It has happened to most of us over the past few years. supply chain resiliencemaintainingpackagingprocurement https://www.procuresuite.io/blog/global-supply-chain-workflow-tips/ Enhance Supply Chain Resilience with Procurement Software Resilient procurement workflows boost global supply chains. This blog discusses how procurement management systems create workflows that withstand challenges. supply chain resilienceenhanceprocurementsoftware https://dezshira.cn/events/details/2026-asian-manufacturing-outlook-navigating-supply-chain-resilience-for-fies.html 2026 Asian Manufacturing Outlook: Navigating Supply Chain Resilience for FIEs | Dezan Shira &... supply chain resiliencemanufacturing outlookasiannavigatingfies https://berlin.cwiemeevents.com/articles/supply-chain-resilience Supply Chain Resilience: European Redundancy Without Loss in Materials | CWIEME Berlin Supply chain resilience starts with materials. Explore how European redundancy can be built without compromising performance. supply chain resilienceeuropeanredundancywithoutloss https://technode.global/2026/05/07/asean-intensifies-regional-push-to-advance-supply-chain-resilience-alongside-green-digital-initiatives/ ASEAN intensifies regional push to advance supply chain resilience alongside green, digital... May 7, 2026 - ASEAN leaders have intensified regional push to advance supply chain resilience alongside green and digital initiatives amid Middle East tensions. supply chain resilienceaseanintensifiesregionalpush https://www.tno.nl/en/safe/social-resilience/cyber-risks-chain-effects/ Cyber risks and supply chain resilience | TNO TNO strengthens processes and supply chains, thus helping to boost the resilience of the Netherlands against cyber threats. Reduce cyber risks with the help of supply chain resiliencecyber riskstno https://www.hda.org/supply-chain-resilience/ Supply Chain Resilience | HDA supply chain resiliencehda https://menews247.com/abu-dhabi-launches-adeed-platform-to-boost-trade-and-supply-chain-resilience/ Abu Dhabi launches ‘ADEED’ platform to boost trade and supply chain resilience - Middle East News... supply chain resilienceabu dhabimiddle eastlaunchesplatform https://www.manh.com/our-insights/resources/articles/how-to-build-a-resilient-agile-supply-chain-for-peak-season-success Supply Chain Resilience & Agility for Peak Season Success | Manhattan Dec 8, 2025 - Learn how retailers can build a resilient, agile supply chain for peak season success with strategies to boost flexibility and reduce risk. supply chain resiliencepeak seasonagilitysuccessmanhattan https://www.campdenbri.co.uk/topics/supply-chain-resilience Supply chain resilience from Campden BRI Multiple global factors are creating significant challenges for food and drink manufacturers. From the ability to source the required ingredient, to a rise in... supply chain resiliencecampdenbri https://feport.eu/news/council-working-party-discusses-supply-chain-resilience-and-critical-infrastructure-protection-brussels/ Council Working Party Discusses Supply Chain Resilience and Critical Infrastructure Protection –... supply chain resiliencecouncil workingcritical infrastructurepartydiscusses https://www.epicor.com/en-gb/solutions/technology/supply-chain-resilience/ Supply Chain Resilience | Epicor UK Supply chain disruption is a question of when, not if. Adapt fast to changing conditions to maximize uptime and profitability. supply chain resilienceepicoruk https://www.advancedmanufacturing.org/leadership-innovation/smart-strategies-to-build-supply-chain-resilience/article_f441eb74-dad6-46ce-8a4c-20140378e35a.html Smart Strategies to Build Supply Chain Resilience | Leadership & Innovation |... Fragile supply chains magnify disruptions, cause loss of market share and threaten U.S. manufacturing resilience. To build stronger chains, manufacturers must... supply chain resiliencesmart strategiesbuildleadershipinnovation https://www.thebci.org/training/supply-chain-resilience-training-course.html Supply Chain Resilience 1-Day Training Course | BCI supply chain resiliencetraining coursedaybci https://www.amrc.co.uk/pages/supply-chain-resilience Supply chain resilience | AMRC Our huge network of manufacturing and digital companies of all sizes, coupled with our years of expertise in the industry, gives us a unique overview of the... supply chain resilienceamrc https://www.aluminum.org/PowerUp Powering Up American Aluminum: A Roadmap for Next Generation Supply Chain Resilience | The Aluminum... supply chain resiliencenext generationpoweringamericanaluminum https://cpostrategy.media/blog/2025/06/02/nearshoring-and-digital-twins-building-supply-chain-resilience-in-the-post-globalisation-era/ Nearshoring and digital twins: Building supply chain resilience in the post-globalisation era -... Jun 2, 2025 - Dr. Amit Kohli, Associate Professor at University Canada West, how digital twins could be a useful tool in accelerating the nearshoring. supply chain resiliencedigital twinsnearshoringbuildingpost https://www.klim.eco/en Supply chain resilience through regenerative practices - Klim Klim partners with farms and companies to scale regenerative practices through Scope 3 projects, carbon credits, and innovative digital solutions. supply chain resilienceregenerativepracticesklim https://www.aspentech.com/en/industries/bulk-chemicals Circular Supply Chain Resilience & Decarbonization | Bulk Chemical Manufacturing | AspenTech AspenTech optimizes bulk chemical manufacturing plant operations to achieve performance, circular supply chain resilience, and decarbonization goals. supply chain resiliencechemical manufacturingcirculardecarbonizationbulk https://supplychainstrategy.media/resource_hub/building-b2b-end-to-end-supply-chain-resilience-and-excellence/ Kbrw - Building B2B end-to-end supply chain resilience and excellence - SupplyChain Strategy supply chain resiliencebuildingendexcellencesupplychain https://www.apllogistics.com/2025/03/charting-supply-chain-resilience-in-chinas-shifting-economic-landscape Charting Supply Chain Resilience in China’s Shifting Economic Landscape | APL Logistics Supply chains are steering through a perfect storm of global upheavals. Fresh off his November 2024 re-election,... supply chain resiliencechartingshiftingeconomiclandscape https://fooddigital.com/videos/josh-cobb-explores-food-supply-chain-resilience-at-qscc Josh Cobb Explores Food Supply Chain Resilience at QSCC | Food and Drink Digital Josh Cobb, Executive Vice President of Supply Chain, discusses the technological implementations and company culture behind QSCC’s supply chain resilience food supply chainjoshcobbexploresresilience https://www.inam.berlin/events/circular-economy-webinars-september Supply chain resilience for critical materials — INAM This initiative aims to establish sustainable value chains in Berlin by leveraging materials innovations. supply chain resiliencecriticalmaterialsinam https://www.unifiedkillchain.com/ Unified Kill Chain: Raising Resilience Against Cyber Attacks Cyber attacks are phased progressions towards strategic objectives. Learn how to raise cyber resilience against cyber attacks with the Unified Kill Chain. kill chainunifiedraisingresiliencecyber https://retailasia.com/event/2026-apac-supply-chain-playbook-ai-resilience-and-smart-trade-offs The 2026 APAC Supply Chain Playbook: AI, Resilience, and Smart Trade-Offs supply chainapacplaybookresiliencesmart https://resiliencemedia.co/swebal-raises-35m-to-rekindle-europes-tnt-supply-chain/ Swebal raises $35M to rekindle Europe’s TNT supply chain – Resilience Media NATO is facing a shortage of TNT, an essential explosive in the manufacturing of weapons. Now, startups are setting up supply chainraisesrekindletntresilience https://www.smartmanufacturingexperience.com/event/news/smart-strategies-to-build-supply-chain-resilience/ Smart Strategies to Build Supply Chain Resilience Manufacturers must shift from reactive to strategic supply chain management, adopting key tactics for supplier diversification, risk mitigation, and... smart strategiessupply chainbuildresilience https://www.silicatecarbon.com/ Silicate | Precision soil pH management for supply chain resilience Silicate optimizes soil pH to enhance farm productivity, reduce greenhouse gas emissions, and improve supply chain resilience. supply chainsilicateprecisionsoilph https://www.efeedlink.com/contents/03-25-2026/97d87b8b-6a14-4237-9c27-5b5c579daff8-0006.html eFeedLink - The Chinese vitamin supply chain: A pillar of resilience In contrast to the pressures affecting energy, minerals, and bulk feed ingredients, the supply of feed vitamins from China to Southeast Asia has remained... supply chainefeedlinkchinesevitaminpillar https://www.bsigroup.com/en-GB/our-expertise/supply-chain/ Supply Chain Security & Resilience | BSI Explore BSI's supply chain services, promoting transparency, efficiency, and resilience in supply chain management. supply chain securityresiliencebsi https://waterwastewaterasia.com/gap-and-fido-ai-collaborate-to-improve-water-resilience-in-supply-chain-communities-india/ Gap and FIDO AI collaborate to improve water resilience in supply chain communities, India | Water... Jun 5, 2025 - Gap Inc. is the first apparel company to join a worldwide multi-stakeholder effort to reduce water wastage using AI. Under a new agreement with FIDO Tech, Gap... water resiliencesupply chaingapfidocollaborate https://logistics.imhbusiness.com/ 19th Supply Chain & Logistics EXPO – Digital Transformation, Sustainable Solutions, and Resilience:... supply chain logisticsdigital transformationsustainable solutionsexporesilience https://www.ltplabs.com/case-studies/how-machine-learning-improves-supply-chain-resilience How Machine Learning improves supply chain resilience Optimal Machine Learning for supply chain planning improving service levels and decision making in grocery retail. machine learningsupply chainimprovesresilience https://www.glean.com/industries/industrials/supply-chain Build resilience across a volatile supply chain Help supply chain teams find cross-chain context, resolve exceptions faster, and scale operational expertise with AI that connects planning, logistics and... build resilienceacrossvolatilesupplychain https://caisoft.com/resources/how-automotive-suppliers-can-build-resilience-against-supply-chain-disruptions/ How Automotive Suppliers Can Build Resilience Against Supply Chain Disruptions Apr 23, 2026 - Learn how automotive suppliers can build resilience against disruptions like shortages and delays with EDI for real-time visibility and faster response to... automotive suppliersbuild resiliencesupply chaindisruptions https://www.maersk.com/insights/resilience/2026/04/20/fmcg-supply-chain-resilience FMCG Logistics Resilience: Strategies to Build a Future‑Ready Supply Chain | Maersk Apr 17, 2026 - Improve FMCG supply chain resilience with visibility, automation, and smarter logistics. Reduce risks and deliver faster, more reliable performance. supply chainfmcglogisticsresiliencestrategies https://www.grantthornton.ae/Media/2026/make-cyber-resilience-the-strongest-link-in-your-supply-chain/ Grant Thornton UAE | Make cyber resilience the strongest link in your supply chain Cyber risk now extends beyond the organisation into the supply chain. Anand Balasubramanian explores why cyber resilience is a board-level governance issue. grant thornton uaecyber resiliencemakestrongestsupply https://www.bsigroup.com/en-IE/our-expertise/supply-chain/ Supply Chain Security & Resilience | BSI Explore BSI's supply chain services, promoting transparency, efficiency, and resilience in supply chain management. supply chain securityresiliencebsi https://www.nsmedicaldevices.com/analysis/how-to-build-resilience-into-the-medical-supply-chain/ How to build resilience into the medical supply chain May 16, 2024 - A look at the world's supply chain in light of the Covid-19 pandemic and how resilience can be built into the medical supply chain. build resiliencemedical supplychain https://www.buildresil.com/ Home | Build Resilience | Energy Assessment | Supply Chain | Government Funding & More Building Resilience; Energy; Supply Chain; Optimisation; First National; Energy Study; Net Zero Home build resilienceenergy assessmentsupply chaingovernment funding https://lucysecurity.com/supply-chain-security-for-cisos/ Supply Chain Security for CISOs: Vendor Resilience Feb 26, 2026 - Supply Chain Security for CISOs requires extending security awareness to suppliers. Learn how to reduce vendor risk with measurable training and oversight. supply chain securitycisosvendorresilience https://www.supplychaindive.com/news/hershey-cocoa-sourcing-resilience-price-shock/817044/ Hershey leans on cocoa sourcing resilience to blunt price shocks | Supply Chain Dive The candy maker is using diversified sourcing, long-term farmer programs and tighter cost controls to offset higher commodity costs. supply chainhersheyleanscocoasourcing