https://www.raad360.com/
RAAD™ | Supply Chain Resilience | raad360.com
Achieve intelligent resilience with the RAAD™ supply chain and value chain risk management software platform - create your own unique risk management...
supply chain resilience
https://www.epicor.com/en/solutions/technology/supply-chain-resilience/
Supply Chain Resilience | Epicor
Supply chain disruption is a question of when, not if. Adapt fast to changing conditions to maximize uptime and profitability.
supply chain resilienceepicor
https://www.avetta.com/blog/how-telecom-companies-can-build-supply-chain-resilience
How Telecom Companies Can Build Supply Chain Resilience | Avetta
Avetta empowers telecom companies to navigate supply chain challenges and build resilience with our Supply Chain Resilience for Telecom solutions.
supply chain resiliencetelecomcompaniesbuildavetta
https://www.digital-bb.de/newsdetail/supply-chain-resilience-platform-matchmaking-zum-aufbau-neuer-lieferketten
Supply Chain Resilience Platform: Matchmaking zum Aufbau neuer Lieferketten | Cluster IKT
Die europäische Plattform zum Aufbau neuer Lieferketten
supply chain resiliencezum aufbauplatformmatchmakingneuer
https://www.dezshira.com/events/details/2026-asian-manufacturing-outlook-navigating-supply-chain-resilience-for-fies.html
2026 Asian Manufacturing Outlook: Navigating Supply Chain Resilience for FIEs | Dezan Shira &...
supply chain resiliencemanufacturing outlookasiannavigatingfies
https://www.nitra.com/resources/supply-chain-resilience-the-role-of-online-medical-supplies-marketplaces
Supply Chain Resilience: The Role of Online Medical Supplies Marketplaces
supply chain resilienceonline medicalrolesuppliesmarketplaces
https://rethinktrade.org/hyperglobalization-supply-chains/
Hyperglobalization vs. Supply Chain Resilience | Rethink Trade
Nov 26, 2025 - A look at how hyperglobalization and the de minimis loophole weakened U.S. supply chains, and why resilience requires more domestic production
supply chain resiliencevsrethinktrade
https://www.koaloo-fi.com/
Koaloo.Fi | Boost Your Supply Chain Resilience and Profits
Boost your supply chain's resilience and profits with Koaloo.Fi's AI-driven solutions.
supply chain resiliencefiboost
https://wiot-group.com/think/en/news/connected-load-carrier-how-digital-assets-empower-supply-cha/
How Digital Assets Boost Supply Chain Resilience | Connected Load Carrier
May 6, 2026 - Discover how digital twins of physical load carriers enhance supply chain efficiency and reduce errors at handovers.
supply chain resiliencedigital assetsboostconnectedload
https://www.clariumhealth.com/
AI-Powered Supply Chain Resilience Platform | Clarium
AI-Powered Supply Chain for Healthcare. Clarium’s supply chain resilience platform provides real-time visibility and intelligent automation to unlock...
ai powered supplychain resilienceplatform
https://www.thebci.org/training/supply-chain-resilience-2-day-training-course.html
Supply Chain Resilience 2-Day Training Course | BCI
supply chain resiliencetraining coursedaybci
https://www.aspentech.com/en/industries/bulk-chemicals/?src=web-apaccn
Circular Supply Chain Resilience & Decarbonization | Bulk Chemical Manufacturing | AspenTech
AspenTech optimizes bulk chemical manufacturing plant operations to achieve performance, circular supply chain resilience, and decarbonization goals.
supply chain resiliencechemical manufacturingcirculardecarbonizationbulk
https://www.maersk.com/insights/resilience/2022/12/07/five-ways-to-build-supply-chain-resilience
Five ways to build supply chain resilience in 2023 | Maersk
Nov 21, 2024 - Worried about supply chain disruptions? Here’s how to improve supply chain resilience in five easy ways to get ready for what’s to come
supply chain resiliencefive waysbuildmaersk
https://www.aspentech.com/en/industries/bulk-chemicals?src=web-apaccn
Circular Supply Chain Resilience & Decarbonization | Bulk Chemical Manufacturing | AspenTech
AspenTech optimizes bulk chemical manufacturing plant operations to achieve performance, circular supply chain resilience, and decarbonization goals.
supply chain resiliencechemical manufacturingcirculardecarbonizationbulk
https://www.foodbusinessreview.com/leadership-perspective/maintaining-supply-chain-resilience-with-packaging-procurement-and-people-nwid-767.html
Maintaining Supply Chain Resilience With Packaging, Procurement and...
May 12, 2026 - It has happened to most of us over the past few years. You get a hankering for that one delicious food that only a particular restaurant makes just the way...
supply chain resiliencemaintainingpackagingprocurement
https://www.indiapharmaoutlook.com/industry-experts/enhancing-clinical-trial-supply-chain-resilience-to-address-global-disruptions-in-india-nwid-3154.html
Enhancing Clinical Trial Supply Chain Resilience to Address Global Disruptions in India
clinical trial supplychain resilienceenhancingaddressglobal
https://www.gdit.com/perspectives/latest/securing-the-edge-driving-supply-chain-resilience-across-the-indo-pacific/
Securing the Edge: Driving Supply Chain Resilience Across the Indo-Pacific | GDIT
GDIT’s Joe McMahon sat down with Colonel Todd Burroughs, Deputy Commanding Officer for Support, 7th Infantry Division Multi-Domain Command, Pacific, to discuss...
supply chain resilienceindo pacificsecuringedgedriving
https://supplychainresiliencehub.com/
Supply Chain Resilience Hub – Building Responsible and Resilient UK Manufacturing Supply Chains.
supply chain resilienceuk manufacturinghubbuildingresponsible
https://www.klim.eco/
Supply chain resilience through regenerative practices - Klim
Klim partners with farms and companies to scale regenerative practices through Scope 3 projects, carbon credits, and innovative digital solutions.
supply chain resilienceregenerativepracticesklim
https://defensescoop.com/video/saps-joe-ditchett-on-supply-chain-resilience-for-modern-defense/
SAP’s Joe Ditchett on supply chain resilience for modern defense | DefenseScoop
Dec 15, 2025 - Joe DItchett | Industry Executive Advisor | SAP
supply chain resiliencejoemoderndefense
https://www.pwc.in/case-studies/building-a-trustworthy-and-resilient-supply-chain.html
Building A Resilient Supply Chain - Resilience In Supply Chain
Learn how to build a trustworthy and resilient supply chain that can withstand disruptions with PwC India's supply chain transformation solutions.
supply chain resiliencebuildingresilient
https://www.themanufacturingoutlook.com/leadership-perspective/maintaining-supply-chain-resilience-with-packaging-procurement-and-people-nwid-1875.html
Maintaining Supply Chain Resilience with Packaging, Procurement and...
Mar 23, 2026 - It has happened to most of us over the past few years.
supply chain resiliencemaintainingpackagingprocurement
https://www.procuresuite.io/blog/global-supply-chain-workflow-tips/
Enhance Supply Chain Resilience with Procurement Software
Resilient procurement workflows boost global supply chains. This blog discusses how procurement management systems create workflows that withstand challenges.
supply chain resilienceenhanceprocurementsoftware
https://dezshira.cn/events/details/2026-asian-manufacturing-outlook-navigating-supply-chain-resilience-for-fies.html
2026 Asian Manufacturing Outlook: Navigating Supply Chain Resilience for FIEs | Dezan Shira &...
supply chain resiliencemanufacturing outlookasiannavigatingfies
https://berlin.cwiemeevents.com/articles/supply-chain-resilience
Supply Chain Resilience: European Redundancy Without Loss in Materials | CWIEME Berlin
Supply chain resilience starts with materials. Explore how European redundancy can be built without compromising performance.
supply chain resilienceeuropeanredundancywithoutloss
https://technode.global/2026/05/07/asean-intensifies-regional-push-to-advance-supply-chain-resilience-alongside-green-digital-initiatives/
ASEAN intensifies regional push to advance supply chain resilience alongside green, digital...
May 7, 2026 - ASEAN leaders have intensified regional push to advance supply chain resilience alongside green and digital initiatives amid Middle East tensions.
supply chain resilienceaseanintensifiesregionalpush
https://www.tno.nl/en/safe/social-resilience/cyber-risks-chain-effects/
Cyber risks and supply chain resilience | TNO
TNO strengthens processes and supply chains, thus helping to boost the resilience of the Netherlands against cyber threats. Reduce cyber risks with the help of
supply chain resiliencecyber riskstno
https://www.hda.org/supply-chain-resilience/
Supply Chain Resilience | HDA
supply chain resiliencehda
https://menews247.com/abu-dhabi-launches-adeed-platform-to-boost-trade-and-supply-chain-resilience/
Abu Dhabi launches ‘ADEED’ platform to boost trade and supply chain resilience - Middle East News...
supply chain resilienceabu dhabimiddle eastlaunchesplatform
https://www.manh.com/our-insights/resources/articles/how-to-build-a-resilient-agile-supply-chain-for-peak-season-success
Supply Chain Resilience & Agility for Peak Season Success | Manhattan
Dec 8, 2025 - Learn how retailers can build a resilient, agile supply chain for peak season success with strategies to boost flexibility and reduce risk.
supply chain resiliencepeak seasonagilitysuccessmanhattan
https://www.campdenbri.co.uk/topics/supply-chain-resilience
Supply chain resilience from Campden BRI
Multiple global factors are creating significant challenges for food and drink manufacturers. From the ability to source the required ingredient, to a rise in...
supply chain resiliencecampdenbri
https://feport.eu/news/council-working-party-discusses-supply-chain-resilience-and-critical-infrastructure-protection-brussels/
Council Working Party Discusses Supply Chain Resilience and Critical Infrastructure Protection –...
supply chain resiliencecouncil workingcritical infrastructurepartydiscusses
https://www.epicor.com/en-gb/solutions/technology/supply-chain-resilience/
Supply Chain Resilience | Epicor UK
Supply chain disruption is a question of when, not if. Adapt fast to changing conditions to maximize uptime and profitability.
supply chain resilienceepicoruk
https://www.advancedmanufacturing.org/leadership-innovation/smart-strategies-to-build-supply-chain-resilience/article_f441eb74-dad6-46ce-8a4c-20140378e35a.html
Smart Strategies to Build Supply Chain Resilience | Leadership & Innovation |...
Fragile supply chains magnify disruptions, cause loss of market share and threaten U.S. manufacturing resilience. To build stronger chains, manufacturers must...
supply chain resiliencesmart strategiesbuildleadershipinnovation
https://www.thebci.org/training/supply-chain-resilience-training-course.html
Supply Chain Resilience 1-Day Training Course | BCI
supply chain resiliencetraining coursedaybci
https://www.amrc.co.uk/pages/supply-chain-resilience
Supply chain resilience | AMRC
Our huge network of manufacturing and digital companies of all sizes, coupled with our years of expertise in the industry, gives us a unique overview of the...
supply chain resilienceamrc
https://www.aluminum.org/PowerUp
Powering Up American Aluminum: A Roadmap for Next Generation Supply Chain Resilience | The Aluminum...
supply chain resiliencenext generationpoweringamericanaluminum
https://cpostrategy.media/blog/2025/06/02/nearshoring-and-digital-twins-building-supply-chain-resilience-in-the-post-globalisation-era/
Nearshoring and digital twins: Building supply chain resilience in the post-globalisation era -...
Jun 2, 2025 - Dr. Amit Kohli, Associate Professor at University Canada West, how digital twins could be a useful tool in accelerating the nearshoring.
supply chain resiliencedigital twinsnearshoringbuildingpost
https://www.klim.eco/en
Supply chain resilience through regenerative practices - Klim
Klim partners with farms and companies to scale regenerative practices through Scope 3 projects, carbon credits, and innovative digital solutions.
supply chain resilienceregenerativepracticesklim
https://www.aspentech.com/en/industries/bulk-chemicals
Circular Supply Chain Resilience & Decarbonization | Bulk Chemical Manufacturing | AspenTech
AspenTech optimizes bulk chemical manufacturing plant operations to achieve performance, circular supply chain resilience, and decarbonization goals.
supply chain resiliencechemical manufacturingcirculardecarbonizationbulk
https://supplychainstrategy.media/resource_hub/building-b2b-end-to-end-supply-chain-resilience-and-excellence/
Kbrw - Building B2B end-to-end supply chain resilience and excellence - SupplyChain Strategy
supply chain resiliencebuildingendexcellencesupplychain
https://www.apllogistics.com/2025/03/charting-supply-chain-resilience-in-chinas-shifting-economic-landscape
Charting Supply Chain Resilience in China’s Shifting Economic Landscape | APL Logistics
Supply chains are steering through a perfect storm of global upheavals. Fresh off his November 2024 re-election,...
supply chain resiliencechartingshiftingeconomiclandscape
https://fooddigital.com/videos/josh-cobb-explores-food-supply-chain-resilience-at-qscc
Josh Cobb Explores Food Supply Chain Resilience at QSCC | Food and Drink Digital
Josh Cobb, Executive Vice President of Supply Chain, discusses the technological implementations and company culture behind QSCC’s supply chain resilience
food supply chainjoshcobbexploresresilience
https://www.inam.berlin/events/circular-economy-webinars-september
Supply chain resilience for critical materials — INAM
This initiative aims to establish sustainable value chains in Berlin by leveraging materials innovations.
supply chain resiliencecriticalmaterialsinam
https://www.unifiedkillchain.com/
Unified Kill Chain: Raising Resilience Against Cyber Attacks
Cyber attacks are phased progressions towards strategic objectives. Learn how to raise cyber resilience against cyber attacks with the Unified Kill Chain.
kill chainunifiedraisingresiliencecyber
https://retailasia.com/event/2026-apac-supply-chain-playbook-ai-resilience-and-smart-trade-offs
The 2026 APAC Supply Chain Playbook: AI, Resilience, and Smart Trade-Offs
supply chainapacplaybookresiliencesmart
https://resiliencemedia.co/swebal-raises-35m-to-rekindle-europes-tnt-supply-chain/
Swebal raises $35M to rekindle Europe’s TNT supply chain – Resilience Media
NATO is facing a shortage of TNT, an essential explosive in the manufacturing of weapons. Now, startups are setting up
supply chainraisesrekindletntresilience
https://www.smartmanufacturingexperience.com/event/news/smart-strategies-to-build-supply-chain-resilience/
Smart Strategies to Build Supply Chain Resilience
Manufacturers must shift from reactive to strategic supply chain management, adopting key tactics for supplier diversification, risk mitigation, and...
smart strategiessupply chainbuildresilience
https://www.silicatecarbon.com/
Silicate | Precision soil pH management for supply chain resilience
Silicate optimizes soil pH to enhance farm productivity, reduce greenhouse gas emissions, and improve supply chain resilience.
supply chainsilicateprecisionsoilph
https://www.efeedlink.com/contents/03-25-2026/97d87b8b-6a14-4237-9c27-5b5c579daff8-0006.html
eFeedLink - The Chinese vitamin supply chain: A pillar of resilience
In contrast to the pressures affecting energy, minerals, and bulk feed ingredients, the supply of feed vitamins from China to Southeast Asia has remained...
supply chainefeedlinkchinesevitaminpillar
https://www.bsigroup.com/en-GB/our-expertise/supply-chain/
Supply Chain Security & Resilience | BSI
Explore BSI's supply chain services, promoting transparency, efficiency, and resilience in supply chain management.
supply chain securityresiliencebsi
https://waterwastewaterasia.com/gap-and-fido-ai-collaborate-to-improve-water-resilience-in-supply-chain-communities-india/
Gap and FIDO AI collaborate to improve water resilience in supply chain communities, India | Water...
Jun 5, 2025 - Gap Inc. is the first apparel company to join a worldwide multi-stakeholder effort to reduce water wastage using AI. Under a new agreement with FIDO Tech, Gap...
water resiliencesupply chaingapfidocollaborate
https://logistics.imhbusiness.com/
19th Supply Chain & Logistics EXPO – Digital Transformation, Sustainable Solutions, and Resilience:...
supply chain logisticsdigital transformationsustainable solutionsexporesilience
https://www.ltplabs.com/case-studies/how-machine-learning-improves-supply-chain-resilience
How Machine Learning improves supply chain resilience
Optimal Machine Learning for supply chain planning improving service levels and decision making in grocery retail.
machine learningsupply chainimprovesresilience
https://www.glean.com/industries/industrials/supply-chain
Build resilience across a volatile supply chain
Help supply chain teams find cross-chain context, resolve exceptions faster, and scale operational expertise with AI that connects planning, logistics and...
build resilienceacrossvolatilesupplychain
https://caisoft.com/resources/how-automotive-suppliers-can-build-resilience-against-supply-chain-disruptions/
How Automotive Suppliers Can Build Resilience Against Supply Chain Disruptions
Apr 23, 2026 - Learn how automotive suppliers can build resilience against disruptions like shortages and delays with EDI for real-time visibility and faster response to...
automotive suppliersbuild resiliencesupply chaindisruptions
https://www.maersk.com/insights/resilience/2026/04/20/fmcg-supply-chain-resilience
FMCG Logistics Resilience: Strategies to Build a Future‑Ready Supply Chain | Maersk
Apr 17, 2026 - Improve FMCG supply chain resilience with visibility, automation, and smarter logistics. Reduce risks and deliver faster, more reliable performance.
supply chainfmcglogisticsresiliencestrategies
https://www.grantthornton.ae/Media/2026/make-cyber-resilience-the-strongest-link-in-your-supply-chain/
Grant Thornton UAE | Make cyber resilience the strongest link in your supply chain
Cyber risk now extends beyond the organisation into the supply chain. Anand Balasubramanian explores why cyber resilience is a board-level governance issue.
grant thornton uaecyber resiliencemakestrongestsupply
https://www.bsigroup.com/en-IE/our-expertise/supply-chain/
Supply Chain Security & Resilience | BSI
Explore BSI's supply chain services, promoting transparency, efficiency, and resilience in supply chain management.
supply chain securityresiliencebsi
https://www.nsmedicaldevices.com/analysis/how-to-build-resilience-into-the-medical-supply-chain/
How to build resilience into the medical supply chain
May 16, 2024 - A look at the world's supply chain in light of the Covid-19 pandemic and how resilience can be built into the medical supply chain.
build resiliencemedical supplychain
https://www.buildresil.com/
Home | Build Resilience | Energy Assessment | Supply Chain | Government Funding & More
Building Resilience; Energy; Supply Chain; Optimisation; First National; Energy Study; Net Zero Home
build resilienceenergy assessmentsupply chaingovernment funding
https://lucysecurity.com/supply-chain-security-for-cisos/
Supply Chain Security for CISOs: Vendor Resilience
Feb 26, 2026 - Supply Chain Security for CISOs requires extending security awareness to suppliers. Learn how to reduce vendor risk with measurable training and oversight.
supply chain securitycisosvendorresilience
https://www.supplychaindive.com/news/hershey-cocoa-sourcing-resilience-price-shock/817044/
Hershey leans on cocoa sourcing resilience to blunt price shocks | Supply Chain Dive
The candy maker is using diversified sourcing, long-term farmer programs and tighter cost controls to offset higher commodity costs.
supply chainhersheyleanscocoasourcing