Robuta

https://www.businesstoday.in/latest/trends/story/greatest-comeback-of-all-time-netizens-hail-isro-for-not-giving-up-after-chandrayaan-2-395261-2023-08-23 'Greatest comeback of all time': Netizens hail ISRO for not giving up after Chandrayaan 2 -... Aug 23, 2023 - Chandrayaan-3 landing: For anyone who followed the Chandrayaan-2 mission closely, the scene of former ISRO Chairman K Sivan breaking down and Prime Minister... all timegiving upgreatestcomebackhail https://government.economictimes.indiatimes.com/news/technology/indias-chandrayaan-3-russias-luna-25-race-to-moons-south-pole-heats-up/102785453 India's Chandrayaan-3, Russia's Luna-25: Race to Moon's south pole heats up, ETGovernment Chandrayaan-3 Luna-25: While Chandrayaan-3 plans to be the first to land on the Moon's south pole, Luna-25's swift trajectory has cast new light, say experts... south poleindiachandrayaanrussialuna https://www.mondaq.com/india/inward-foreign-investment/1360402/indias-chandrayaan-moonshot-time-for-a-robust-legislative-foundation-to-govern-indias-space-sector India's Chandrayaan Moonshot - Time For A Robust Legislative Foundation To Govern India's Space... From discovering water on the moon in 2008, and reaching Mars in its very first attempt in 2014, to being the first country to soft land its lunar exploration... indiachandrayaanmoonshottimerobust https://www.wionews.com/tags/chandrayaan-2-0 Chandrayaan 2 News - Latest Chandrayaan 2 News, Breaking Chandrayaan 2 News, Chandrayaan 2 News... Get top and latest Chandrayaan 2 News - Read Breaking Chandrayaan 2 News and Chandrayaan 2 News Headlines. WION is leading news channel worldwide get all... news latestchandrayaanbreaking https://www.rediff.com/news/report/where-no-one-has-gone-before-the-moment-chandrayaan-3-landed/20230823.htm?print=true Where no one has gone before: The moment Chandrayaan-3 landed - Rediff.com India created history on Wednesday when the lander module of Chandrayaan-3 touched down on the lunar south pole, propelling the country to an exclusive club of... no onethe momentgonechandrayaanlanded https://www.indianmirror.com/blog/article.php?post=chandrayaan-3-vikram-039-s-hop-offers-fresh-insights-on-moon-039-s-surface Chandrayaan-3: Vikram's Hop Offers Fresh Insights On Moon's Surface - indianmirror.com fresh insightschandrayaanvikramhopoffers https://cricshots.com/mumbai-indians-see-fortune-aligned-chandrayaan-3-success-bodes-well-for-indias-world-cup-ambitions/ Mumbai Indians See Fortune Aligned: Chandrayaan-3 Success Bodes Well For India's World Cup Ambitions Aug 24, 2023 - Mumbai Indians find a positive omen in Chandrayaan-3's success, hoping for India's cricketing fortune to align in the upcoming World Cup. mumbai indiansworld cupseefortunealigned https://trunicle.com/tag/chandrayaan-3/ Chandrayaan-3 | Trunicle chandrayaan https://www.newzdaddy.com/chandrayaan-3s-exciting-moon-landing-adventure/?amp=1 Chandrayaan-3's Exciting Moon Landing Adventure - Newz Daddy Aug 22, 2023 - India is getting ready for a remarkable event as Chandrayaan-3 aims to softly land its Vikram Lander along with the Pragyaan rover on the moon's south pole. moon landingchandrayaanexcitingadventurenewz https://uae24x7.com/tag/chandrayaan/ Chandrayaan Archives - UAE24x7 In a historic achievement, India's space agency ISRO has successfully landed the Chandrayaan-3 rover on the Moon's south pole, making chandrayaanarchives https://room.eu.com/tag/Chandrayaan-2?page=2&per-page=6 Chandrayaan-2 - ROOM Space Journal Read articles and the latest news about Chandrayaan-2 chandrayaanroomspacejournal https://www.ndtv.com/video/chandrayaan-3-lander-automated-ex-isro-chief-k-sivan-to-ndtv-718379 Chandrayaan-3 Lander Automated: Ex-ISRO Chief K Sivan To NDTV Ex-ISRO Chief K Sivan, during a chat with NDTV, said that once the deboosting maneuver of Chandrayaan-3's lander 'Vikram' begins, it will be on 'automatic... chandrayaanlanderautomatedexisro https://hothardware.com/news/chandrayaan-3-mission-sends-photos-of-lunar-surface Historic Chandrayaan-3 Moon Mission Sends Breathtaking Photos Of Lunar Surface | HotHardware Aug 7, 2023 - Chandrayaan-3 marks India's third lunar exploration mission which will also include a lunar landing of a rover. historicchandrayaanmoonmissionsends https://utkarsh.com/hi/current-affairs/national/science-technology-news/uncontrolled-part-of-chandrayaan-3-rocket-returns-to-earths-atmosphere Uncontrolled Part of Chandrayaan-3 Rocket Re-Enters in Earth A portion of the Chandrayaan-3 rocket, which successfully launched India's third lunar mission in July 2023, made an uncontrolled re-entry into Earth's... part ofuncontrolledchandrayaanrocketearth https://www.fortuneindia.com/macro/chandrayaan-3-lander-separates-moon-landing-countdown-begins/113762 Chandrayaan-3: Lander separates; Moon landing countdown begins The Lander will now make a soft landing on the Moon and deploy the Rover, which will carry out an "in-situ chemical analysis" of the Moon's surface moon landingchandrayaanlanderseparatescountdown https://www.marketinginasia.com/chandrayaan-3-unveiling-indias-next-lunar-odyssey/ Chandrayaan-3: Unveiling India's Next Lunar Odyssey Jul 13, 2023 - Chandrayaan-3: India's continued exploration of the moon is fueled by resilience and innovation. Learn more about how ISRO is setting new benchmarks in lunar... chandrayaanunveilingindianextlunar https://hindi.newslaundry.com/2023/08/29/2023/08/24/roznamcha-24-august-chandrayaan-3-mission-moon-soft-landing-successful-made-headlines-today roznamcha 24 august chandrayaan 3 mission moon soft landing successful made headlines today roznamcha 24 august chandrayaan 3 mission moon soft landing successful made headlines today soft landingheadlines todayaugustchandrayaanmission https://www.domain-b.com/aviation-aerospace/space-aero/space-missions/chandrayaan-i-loses-critical-sensor-may-curtail-operations Chandrayaan-I loses critical sensor, may curtail operations | Domain-b.com Jul 17, 2009 - After a successful eight-month long orbit, India's lunar probe Chandrayaan-I has developed a malfunction that may compel a shortening of its operational life. b comchandrayaanlosescriticalsensor https://curriculum-magazine.com/iit-madras-honours-its-alumni-who-were-part-of-the-historic-chandrayaan-3-mission/ IIT Madras honours its alumni who were part of the historic Chandrayaan-3 mission - Curriculum... Oct 9, 2023 - Indian Institute of Technology Madras (IIT Madras) honoured 12 of its alumni in Indian Space Research Organisation (ISRO) who played a pivotal iit madraspart ofhonoursalumnihistoric https://tech.hindustantimes.com/amp/tech/news/xposat-mission-launch-isro-to-start-2024-with-a-bang-after-chandrayaan-3-mission-aditya-l1-mission-triumphs-71704034481344.html XPoSat Mission launch: ISRO to start 2024 with a bang after Chandrayaan-3 mission, Aditya-L1... Jan 1, 2024 - After 2023 success with Chandrayaan-3 mission and Aditya-L1 mission, ISRO set for XPoSat Mission launch on January 1, 2024. with amissionlaunchisrostart https://see.news/indias-chandrayaan-3-exits-spacecraft-starts-moving-on-lunar-south-pole-surface Video: India's 'Chandrayaan-3' Exits Spacecraft, Starts Moving on Lunar South Pole Surface | Sada... Indian lunar rover "Chandrayaan-3" started its journey on the moon, Thursday, as it departed its spacecraft. moving onsouth polevideoindiachandrayaan https://www.manipal.edu/mu/news-events/public-live-screening-of-the-chandrayaan-3.html Live Screening of Chandrayaan-3 Live Screening of the Chandrayaan-3 livescreeningchandrayaan https://www.indiandefensenews.in/2023/11/us-russia-eagerly-await-india-sharing.html US, Russia Eagerly Await India Sharing Information of Chandrayaan-3: Union Minister Dr Jitendra... Chandrayaan-3 made a soft landing on the moon on August 23, scripting history and becoming only the fourth country to do so. India's solar m... sharing informationunion ministeruseagerlyawait https://wlext.is/tag/space-gen-chandrayaan-final/ Space Gen: Chandrayaan Final Archives - WLEXT spacegenchandrayaanfinalarchives https://www.telegraphindia.com/edugraph/campus/isro-scientist-unveils-space-exploration-missions-at-space-indias-eduodyssey-chandrayaan-3-and-beyond/cid/1972430 Chandrayaan 3 | ISRO Scientist Unveils Space Exploration Missions at SPACE India's EduOdyssey:... space explorationchandrayaanisroscientistmissions https://www.timesnownews.com/web-stories/technology/top-5-isro-space-missions-that-made-india-proud/photostory/111836673.cms Top 5 ISRO Space Missions That Made India Proud: Aryabhata Mission, Chandrayaan 1, Chandrayaan 3,... Check out these space missions by ISRO which made India proud - Aryabhata Mission, Chandrayaan 1, Chandrayaan 3, Mangalyaan mission, and Aditya L1. space missionstopisromadeindia https://eliax.com/index.cfm?post_id=7012 :: eliax.com - La Sonda Chandrayaan-1 de la India confirma misiones Apollo en la Luna con fotos eliax, Para Mentes Curiosas... eliaxlasondachandrayaande https://www.nilkantho.in/tag/chandrayaan-3/ Chandrayaan-3 NILKANTHO.IN is one of the oldest Bengali Web Portals. It features Daily News, Offbeat News, Healthcare, Celebrity Interviews, Mythology etc. chandrayaan https://currentaffairs.adda247.com/cabinet-clears-chandrayaan-4-and-venus-orbiter-mission-for-space-exploration/ Cabinet Clears Chandrayaan-4 and Venus Orbiter Mission for Space Exploration Sep 19, 2024 - The Union Cabinet has approved two major space missions: Chandrayaan-4 and the Venus Orbiter Mission (VOM). Chandrayaan-4, costing Rs 2104.06 crore, will... venus orbiter missionfor spacecabinetclearschandrayaan https://www.gadgets360.com/science/news/chandrayaan-2-completes-a-year-in-moon-orbit-has-adequate-fuel-for-7-years-more-isro-2282916 Chandrayaan-2 Completes a Year in Moon Orbit, Has Adequate Fuel for 7 Years More: ISRO | Technology... Aug 21, 2020 - India's second lunar mission Chandrayaan-2 completed one year in orbit around the moon on Thursday and all instruments are currently performing well and there... a year inchandrayaancompletesmoonorbit https://technoingg.com/tag/chandrayaan-2/ Chandrayaan 2 Archives - Technoingg Connecting People With IT chandrayaanarchives https://www.latestly.com/agency-news/india-news-india-fourth-country-to-land-space-craft-on-moon-5359530.html Chandrayaan 3 Successfully Lands on Moon: India Becomes Fourth Country to Achieve Lunar Landing... Aug 23, 2023 - India's third lunar mission - Chandrayaan-3 - on Wednesday landed near the South Pole of the moon, a place where no spacecraft has travelled so far. No other... lunar landingchandrayaansuccessfullylandsmoon https://centralchronicle.in/chandrayaan-3-lander-module-successfully-separates-from-propulsion-module/ Chandrayaan-3: Lander Module successfully separates from Propulsion Module - Central Chronicle Aug 17, 2023 - Read Bengaluru, Aug 17 (PTI) Lander Module of Chandrayaan-3 spacecraft comprising the lander and rover has successfully separated from the Propulsion Module,... chandrayaanlandermodulesuccessfullyseparates https://interviewtimes.net/chandrayaan-3-mission-gets-boost-from-private-sector-collaboration/ Chandrayaan-3 Mission Gets Boost from Private Sector Collaboration - Interview Times Aug 24, 2023 - The Indian Space Research Organisation's (ISRO) Chandrayaan-3 spacecraft safely landed near the south pole of the Moon on Wednesday evening, marking a historic private sector collaborationchandrayaanmissiongetsboost https://islamabadpost.com.pk/india-cabinet-celebrates-chandrayaan-3-mission/ India cabinet celebrates Chandrayaan-3 Mission - Islamabad Post Aug 31, 2023 - India cabinet celebrates Chandrayaan-3 Mission indiacabinetcelebrateschandrayaanmission https://www.indiatodayne.in/national/story/chandrayaan-3-only-4313-km-away-from-the-moon-successfully-performs-orbit-reduction-manoeuvre-627662-2023-08-07 Chandrayaan-3 only 4,313 km away from the moon, successfully performs orbit reduction manoeuvre -... Aug 7, 2023 - The Indian Space Research Organisation said it has successfully carried out the orbit reduction manoeuvre of India's third moon mission Chandrayaan-3. from the moonchandrayaankmawaysuccessfully https://news.abplive.com/science/chandrayaan-3-soft-landing-vikram-lander-pragyan-rover-experiments-functions-moon-lunar-surface-help-humanity-1625246/amp Chandrayaan 3 Soft Landing Vikram Lander Pragyan Rover Experiments Functions Moon Lunar Surface... Chandrayaan-3: Vikram is a lander, and hence, will conduct experiments by remaining in a fixed position. Meanwhile, Pragyan will explore the lunar surface,... soft landingchandrayaanvikramlanderpragyan https://currentaffairs.khanglobalstudies.com/tags/chandrayaan-3-launch-date/ chandrayaan-3 launch date Archives - UPSC Current Affairs 2025 upsc current affairslaunch datechandrayaanarchives https://jkalerts.com/tag/chandrayaan-3-successfully-lands-on-moons-south-pole/ Chandrayaan-3 successfully lands on Moon's south pole | Govt Private Jobs updates Jammu, Kashmir,... Govt Private Jobs updates Jammu Kashmir Ladakh India JKSSB JKPSC JKBOSE UNIVERSITY south poleprivate jobsjammu kashmirchandrayaansuccessfully https://rajatsharma.in/chandrayaan-reaches-the-moon-what-next/ Rajat Sharma CHANDRAYAAN REACHES THE MOON: WHAT NEXT? - Rajat Sharma Aug 24, 2023 - August 23, 2023 shall remain a red-letter day, a day of pride for more than a billion Indians, both in India and across the globe. It was celebration time as... the moonwhat nextsharmachandrayaan https://www.indiatoday.in/science/story/new-isro-chief-narayanan-priorities-gaganyaan-chandrayaan-space-station-venus-mission-2661575-2025-01-08 Isro chief V Narayanan on Gaganyaan Chandrayaan 4 missions - India Today Jan 8, 2025 - In an exclusive interview with India Today, Narayanan, an expert in rocket and spacecraft propulsion, said every mission was a challenge. india todayisrochiefvnarayanan https://apacnewsnetwork.com/2025/02/india-to-launch-chandrayaan-4-in-2027/ India to Launch Chandrayaan-4 in 2027 Feb 8, 2025 - India will launch the Chandrayaan-4 mission in 2027 to bring back uncontaminated lunar samples, Union Science and Technology Minister Jitendra Singh announced. indialaunchchandrayaan https://indiawhispers.com/2021/07/28/chandrayaan-3-launching-in-2022/ Chandrayaan-3 launching in 2022 - India Whispers chandrayaanlaunchingindiawhispers https://iphoneswallpapers.com/chandrayaan-3-vikram-lander-isro-iphone-wallpaper-4k/ Chandrayaan 3 Vikram Lander ISRO iPhone Wallpaper 4K - iPhone Wallpapers iphone wallpaperchandrayaanvikramlanderisro https://rateitall.com/reviews/chandrayaan-3 Chandrayaan-3 Reviews | RateItAll Read reviews about Chandrayaan-3 from real people and rate it yourself! chandrayaanreviews https://asianatimes.com/pm-modi-names-lunar-landing-site-shivshakti/ Chandrayaan-3 Triumph: PM Modi Names Lunar Landing Site 'Shivshakti' - Asiana Times Oct 12, 2023 - Prime Minister Narendra Modi expressed deep emotion while addressing the dedicated team of scientists at the Indian Space Research Organisation (ISRO). The PM pm modilunar landingchandrayaantriumphnames https://thejuniorage.com/tag/chandrayaan-3/ chandrayaan 3 - The Junior Age chandrayaanjuniorage https://cityplusnews.in/tag/chandrayaan-2/ Chandrayaan 2 - CITYPLUS NEWS chandrayaannews https://www.spacerealm.live/launch/lvm-3-chandrayaan-4-first-launch Chandrayaan-4 First Launch - Space launch mission informati Learn more about the space launch mission Chandrayaan-4 First Launch launched by rocket launch provider Indian Space Research Organization o space missionchandrayaanfirstlaunchinformati https://www.arabtimesonline.com/news/kuwait-amir-congratulates-indian-pm-on-successful-chandrayaan-3-moon-mission/ Kuwait Amir congratulates Indian PM on successful Chandrayaan-3 moon mission | arabtimes KUWAIT, Aug 23: His Highness the Amir Sheikh Nawaf Al-Ahmad Al-Jaber Al-Sabah sent a cable to Indian Prime Ministe... kuwaitamircongratulatesindianpm https://www.teslarati.com/deepspace-india-fourth-country-soft-moon-landing/chandrayaan-2-orbiter-and-lander-isro-2-c/ Chandrayaan-2 orbiter and lander (ISRO) 2 (c) - TESLARATI chandrayaanorbiterlanderisro https://telugustop.com/chandrayaan-3-passes-isros-vibration-tests-latest-eng-news-1573395 Chandrayaan-3 passes ISRO#8217;s vibration tests - Chandrayaan, Chennai, Isro, Isros, Kollywood,... Mar 16, 2023 - Chennai March 16 : Indian Space Agency On Thursday Said It Had Successfully Completed The Tests To Check Chandrayaan-3 -- Moon Spacecraft Withstand Harsh... chandrayaanpassesisrovibrationtests https://www.nagpurtoday.in/chandrayaan-2-communication-with-vikram-has-been-lost-isro/ Chandrayaan 2- Communication with Vikram has been lost: ISRO Sep 6, 2019 - Okay, so this is not the news we were hoping for... But, ISRO has just announced that they have lost communication with Vikram lander. The data is right -... has beenchandrayaancommunicationvikramlost https://goreaditright.com/agency-news/first-and-foremost-song-on-chandrayaan-3-mission-moon-by-team-mfi/ First and Foremost song on CHANDRAYAAN 3 Mission Moon by Team MFI - Go Read It Right Oct 4, 2023 - Successful Journey of MFI Achiever RUDRANSH from Actor to Lyricist of #ChandKoChuLiya In the boundless realm of creativity, there are no confines, no borders... go read itby teamfirstforemostsong https://www.space.com/chandrayaan-3-sulfur-measurements-lunar-science-expert-voices Chandrayaan-3's measurements of sulfur open the doors for lunar science | Space Oct 10, 2023 - Sulfur in soils near the moon's poles might help astronauts live off the land one day, making these measurements an example of science that enables exploration. open the doorschandrayaanmeasurementssulfurlunar https://www.newsbytesapp.com/news/science/register-to-watch-chandrayaan-2-launch-live-in-sriharikota/story Now, you can watch Chandrayaan-2 launch in Sriharikota: Here's how On July 15, ISRO will launch Chandrayaan-2, its second mission to Moon you canwatchchandrayaanlaunch https://aiaa.org/tag/chandrayaan-3/ Chandrayaan-3 Archives - AIAA - Shaping the future of aerospace | AIAA shaping the futurechandrayaanarchivesaiaaaerospace https://www.rakhibazaar.com/products/krishna-ji-rakhi-with-chandrayaan-3-mug-51841.html Send Krishna ji Rakhi with Chandrayaan 3 Mug Online | Rakhibazaar.com Buy Krishna ji Rakhi with Chandrayaan 3 Mug online in India from Rakhibazaar.com at reasonable price and Send Krishna ji Rakhi with Chandrayaan 3 Mug with FREE... sendkrishnajirakhichandrayaan https://www.iadb.in/2023/08/14/chandrayaan-3-luna-25-innovation-strategy-economics-of-two-moon-missions/ Chandrayaan-3 & Luna-25: Innovation, Strategy & Economics Of Two Moon Missions - Indian Aerospace... Aug 14, 2023 - In the high-tech world of space exploration, where ambitions soar and budgets are meticulously crafted, this year's launch of India's Chandrayaan-3 and... innovation strategymoon missionschandrayaanlunaeconomics https://voices.shortpedia.com/tag/chandrayaan-3/ chandrayaan 3 : Latest News, Articles, Stories & Videos on chandrayaan 3 | Shortpedia Voices latest news articlesshortpedia voiceschandrayaanstoriesvideos https://indiannewspapersociety.org/category/chandrayaan-3/ Chandrayaan-3 - Indian Newspaper Society chandrayaanindiannewspapersociety https://superkalam.com/upsc-mains/previous-year-question-paper/2017/india-has-achieved-remarkable-successs-in-unmanned-space-missions-including-the-chandrayaan-and-mars-orbiter-mission-but-a4fb4a51-b8a6-4e21-8a0e-6f90fd214979 India has achieved remarkable successs in unmanned space missions including the Chandrayaan and... space missionsindiaachievedremarkableunmanned https://www.bollywoodkibaten.in/TV-Serial-News/chandrayaan-3-gets-set-to-take-off-proud-moment-for-india-says-celebs/33378 Chandrayaan 3 gets set to take off! Proud moment for India, says celebs Feb 27, 2026 - Chandrayaan 3 gets set to take off! Proud moment for India, says celebs set totake offproud momentfor indiachandrayaan https://mindplan.in/notes/upsc-english/lessons/xlvi-chandrayaan-3-everything-you-need-to-know/ xlvi. Chandrayaan 3: Everything you need to know Jun 26, 2025 - xlvi. Chandrayaan 3: Everything you need to knowChandrayaan 3 spacecraft is the 3rd lunar exploration expedition, outlined by the Indian Space Research... everything you needxlvichandrayaanknow https://www.indiatvnews.com/science/national-space-day-chandrayaan-3-mission-success-august-23-indian-govt-latest-updates-2023-10-14-897815 Govt declares August 23 as 'National Space Day' to commemorate success of Chandrayaan-3 Mission |... Oct 14, 2023 - Chandrayaan-3 touched down on the lunar south pole on August 23, making India the first country to land on the uncharted surface. national space daygovtdeclaresaugustcommemorate https://khabarinfra.com/isros-lunar-mission-chandrayaan-3-lifts-off-landing-on-aug-23-24/ ISRO's lunar mission: Chandrayaan-3 lifts off, landing on Aug 23-24 Jul 14, 2023 - Mounted on LVM-3, Chandrayaan-3, a lunar mission of ISRO successfully lifted off from Satish Dhawan Space Centre in Sriharikota on July 14 isrolunarmissionchandrayaanlifts https://earthzine.org/first-set-of-beautiful-images-of-earth-from-chandrayaan-2-mission-released/ First set of beautiful images of Earth from Chandrayaan 2 mission released - Earthzine Aug 5, 2019 - The first set of images of Earth captured by the Chandrayaan 2 moon-exploration program of the Indian Space Research Organization (ISRO) have been released.... beautiful imagesfirstsetearthchandrayaan