https://dev.to/ellacmd/built-my-portfolio-with-antigravity-and-deployed-to-cloud-run-in-one-day-ihi
This is a submission for the New Year, New You Portfolio Challenge Presented by Google AI ... Tagged with devchallenge, googleaichallenge, portfolio, gemini.
cloud runbuiltportfolioantigravitydeployed
https://dev.to/googleworkspace/are-you-ready-for-google-cloud-next-21n1
Join us for Google Cloud Next 2025 in Las Vegas from April 9 - 11! ... Tagged with cloudnext, googleworkspace, google.
google cloud nextdev communityready
https://www.techtarget.com/searchsoftwarequality/news/366567111/Docker-Build-Cloud-claims-speed-boost-for-dev-workflows
Docker's Build Cloud service, made generally available this week, offloads and caches container image builds on AWS to boost performance.
docker build cloudspeed boostclaimsdevworkflows
https://dev.to/honeybadger/build-an-uptime-monitoring-system-in-ruby-with-gce-cloud-storage-and-pubsub-35bk
This article was originally written by Subomi Oluwalana on the Honeybadger Developer Blog. Uptime... Tagged with ruby.
uptime monitoringbuildsystemrubygce
https://dev.to/jajera/how-to-set-up-a-billing-account-in-google-cloud-30lg
Step-by-step guide for creating a billing account in GCP so you can unlock full resource access and enable free-tier usage. Tagged with gcp, billing,...
billing accountgoogle cloudset
https://dev.to/perennialautodidact/connecting-stripe-webhooks-to-firebase-cloud-functions-on-localhost-using-localtunnel-55o9
Connecting Stripe Webhooks to Firebase Cloud Functions on localhost using localtunnel. ... Tagged with firebase, stripe, javascript, react.
cloud functionsconnectingstripewebhooksfirebase
https://dev.to/codesphere/cloud-deployments-live-code-sync-from-visual-studio-code-31ha
Codesphere has its own cloud based code editor. It is optimized for speed and works as a simple... Tagged with tutorial, vscode, sync, codesphere.
cloud deploymentslive codevisual studiosyncdev
https://dev.to/gde/mcp-development-with-swift-cloud-run-and-gemini-cli-374a
Jan 12, 2026 - Leveraging Gemini CLI and the underlying Gemini LLM to build Model Context Protocol (MCP) AI... Tagged with agents, gemini, swift, mcps.
mcp developmentcloud rungemini cliswift
https://dev.to/chinmaykb/working-with-firebase-database-made-easier-with-withconverter-473n
Disclaimer - This article is not about how to set up cloud firestore. firebase.flutter.dev is a good... Tagged with flutter, firebase, dart, serialization.
cloud firestoreworkingfirebasemadeeasier
https://itbrief.news/story/cncf-finds-strong-bond-between-cloud-native-dev-ai-tools
NVIDIA Triton and Metaflow lead in enterprise adoption as 41% of AI developers embrace scalable, cloud-based AI systems for core tasks.
strong bondcloud nativeamp aicncffinds
https://dev.to/hedlund/google-cloud-functions-with-private-go-dependencies-38ib
Anyone who has deployed a Google Cloud Function written in Go knows that there are a number of restr... Tagged with go, terraform, googlecloud, cloudfunctions.
google cloud functionsdev communityprivatedependencies
https://dev.to/aws-builders/cloud-agnostic-multi-cloud-hybrid-cloud-whats-the-difference-and-when-would-you-use-each-2gk2
These three phrases are often used interchangeably, but they are not the same thing. This article looks at the differences and provides some example criteria...
cloud agnosticmultihybriddifference
https://dev.to/jianzs/building-cloud-native-applications-made-easy-with-pluto-a-guide-for-developers-3l9
Developers define variables in their code, and Pluto takes care of automatically creating and... Tagged with typescript, tutorial, serverless, cloudnative.
cloud native applicationsmade easybuildingplutoguide
https://www.prweb.com/releases/nexcess-brings-dev-sites-to-wordpress-and-woocommerce-cloud-hosting-869133071.html
/PRNewswire-PRWeb/ -- Nexcess has announced the introduction of Cloud Dev Sites to the Nexcess Cloud. The new Dev Sites allow WordPress and WooCommerce cloud...
cloud hostingnexcessbringsdevsites
https://dev.to/cemkeskin84/versioning-data-and-pipeline-with-git-dvc-and-cloud-storage-5cpd
Introduction The vast majority of data science projects are born into Jupyter Notebooks.... Tagged with datascience, dvc, git, python.
cloud storageversioningdatapipelinegit
https://dev.to/johnkevinlosito/understanding-the-osi-7-layer-model-a-foundation-for-cloud-engineering-2a28
As I embark on my journey to cloud roles, it is essential to have a solid understanding of the OSI... Tagged with aws, cloudcomputing, cloud, networking.
understandingosilayermodelfoundation
https://dev.to/codesphere/building-an-ai-powered-search-in-nodejs-using-qdrant-cloud-3ckh
Introduction Since the launch of ChatGPT, we've been seeing more and more use cases for... Tagged with tutorial.
ai powered searchnode jsbuildingusingqdrant
https://dev.to/ibmdeveloper/deploy-a-cloud-native-application-to-code-engine-in-5-easy-steps-4bcg
Hello, IBM Developers! Welcome to Tutorial Tuesdays! When I was first learning how to code...
cloud nativedeployapplicationcodeengine
https://dev.to/aws-builders/aws-iam-outbound-oidc-with-google-cloud-identity-pool-5ak7
Nov 24, 2025 - Recently, AWS introduced a new feature in IAM, that allows you to sign JWT tokens using managed OIDC... Tagged with google, serverless, aws, security.
google cloud identityaws iamoutboundoidcpool
https://www.midaxo.com/
Midaxo Cloud for corporate development and M&A. Deliver higher deal value and faster inorganic growth with purpose-built M&A software work management solution.
software cloudcorp dev
https://dev.to/aairom/creating-an-ibm-cloud-api-key-for-watsonxai-3p94
Introduction When you work in watsonx.ai environment on IBM Cloud, one day or another... Tagged with ibm, cloud, apikey, watsonx.
ibm cloudapi keycreatingwatsonxai
https://dev.to/rob117/serverless-backends-with-aws-cloud-email-lambda-and-dynamodb
Let's make some Lambda and email magic happen! AWS Serverless technologies. Tagged with aws, lambda, mailgun, node.
aws cloudserverlessbackendsemaillambda
https://dev.to/aws-builders/cloud-computing-why-should-tech-beginners-learn-it-2khe
Cloud is everywhere, and we often do not even notice it, but it's part of our lives, whether we are... Tagged with beginners, cloud, aws, cloudcomputing.
cloud computingtechbeginners
https://dev.to/bleuiot/sending-ble-air-quality-data-to-arduino-cloud-using-bleuio-f3
Bluetooth Low Energy (BLE) devices are widely used for environmental monitoring, but getting their... Tagged with bluetoothlowenergy, bleuio, hibouair, arduino.
air quality datasendingblearduinocloud
https://dev.to/jito/microservices-architecture-on-aws-scalable-flexible-and-reliable-cloud-solutions-1eao
Introduction In today's rapidly evolving digital landscape, businesses are constantly looking for... Tagged with aws, microservices, cloud, tutorial.
microservices architecturereliable cloudawsscalableflexible
https://cloud.google.com/events/google-dev-cloud-day-zurich?utm_source=website&%3Butm_medium=blog&%3Butm_campaign=FY25-Q1-emea-EME31378-physicalevent-er-Google-dev-cloud-day-Zurich-Tango&%3Butm_content=google-dev-webcard&%3Butm_term=-&authuser=1&hl=tr
Reserve your seat for a day of technical talks and hands-on workshops to discover Gemini 2.0 and get practical experience with interactive labs design
googledevclouddayzurich
https://dev.to/aaditunni/free-aws-cloud-project-bootcamp-1kjc
[49/100] #100DaysOfCloud Today, I completed the Week 0 of the FREE AWS Cloud Project Bootcamp by... Tagged with aws, cloud, awscommunity, 100daysofcloud.
aws clouddev communityfreeprojectbootcamp
https://dev.to/jeyy/cloud-security-with-aws-iam-a-quick-hands-on-361f
Managing Users, Permissions, and EC2 Access Today, I worked on a cloud security project... Tagged with cloud, aws, iam, security.
cloud securityaws iamquickhandsdev
https://www.soup.dev/home
Get help with building your application or system with technologies such as AWS, Rust, or Python. Soup.dev provides AWS architecture and AWS development...
cloud developmentsoup
https://dev.to/aws-builders/accelerating-ai-innovation-with-the-aws-cloud-adoption-framework-28hk
Introduction Cloud adoption is critical for organizations looking to leverage Artificial... Tagged with ai, genai, machinelearning.
cloud adoption frameworkai innovationacceleratingawsdev
https://dev.to/aws-builders/awscloud-computing-101-55dp
"Cloud Computing" is the need-based provision of IT resources via the Internet at usage-based prices.... Tagged with aws, cloud, cloudskills, beginners.
aws cloud computingdev community
https://dev.to/aws-builders/introducing-managed-instances-in-the-cloud-2d4h
For many years, organizations embracing the public cloud knew there were two main types of compute... Tagged with aws, serverless, containers, kubernetes.
cloud devintroducingmanagedinstancescommunity
https://dev.to/giasuddin90/aws-certified-cloud-practitionar-accp-exam-notes-cheatsheet-never-miss-to-read-before-exam-33k2
The following table lists the main content domains and their weightings. Domain % of... Tagged with aws, cloudpractitioner, cloud, devops.
exam notesawscertifiedcloudaccp
https://developers.google.com/web/shows/google-io/2014/deep-dive-google-cloud-messaging-for-chrome
A deep dive into cross-platform messaging, with a focus on Chrome's API and implementations. [ed: similar talk from android]
google cloud messagingdeep diveweb devchrome
https://dev.to/g33kzone/secure-by-design-integrating-security-policies-from-code-to-cloud-with-terraform-2opg
Introduction: A Balancing Act Between Agility and Security In the fast-paced world of Cloud... Tagged with devops, cloud, engineering, terraform.
security policiessecuredesignintegratingcode
https://dev.to/jei/part-1-concepts-of-code-quality-in-sonar-cloud-318j
In engineering teams/tribes, we often find ourselves stuck in a dilemma of choosing a suitable and... Tagged with sonarcloud, codequality, cloud, github.
code qualitycloud devpartconceptssonar
https://dev.to/serverless_inc/making-an-automatic-spotify-playlist-with-serverless-cloud-and-slack-3b8n
Originally posted at Serverless How to build a Spotify Playlist Slackbot with Serverless... Tagged with serverless, cloud, spotify, slack.
spotify playlistmakingautomaticserverlesscloud
https://dev.to/azeemah/from-scripts-to-cloud-my-hands-on-guide-to-ml-devops-2kbg
As a DevOps engineer, I'm used to automating backend systems, deploying apps, and scaling... Tagged with ai, devops, opensource, aws.
scriptscloudhandsguideml
https://dev.37signals.com/bringing-our-apps-back-home/
For the Operations team at 37signals, the biggest effort in 2023 is removing our dependencies on the cloud and migrating our application stacks back into the...
devcloudbringing
https://dev.to/yugabyte/how-to-connect-a-heroku-java-app-to-a-cloud-native-database-58h1
Ahoy, matey! I'm back from a short vacation and ready to continue my pet project: geo-distributed... Tagged with webdev, database, java, heroku.
connectherokujavaappcloud
https://dev.to/mohamednasser018/set-up-deepseek-on-huawei-cloud-with-docker-and-open-webui-1p37
Step 1: Log in to Huawei Cloud Console Log in to your Huawei Cloud account. In the... Tagged with ai, deepseek, cloud, devops.
huawei cloudsetdeepseekdockeropen
https://dev.to/urishaked/curl-the-cloud-20gb-files-and-i-7g9
A quick tip how to use the cloud to transfer humongous files between different cloud services using c... Tagged with linux, bash, aws, productivity.
dev communitycurlcloudfiles
https://www.windowscentral.com/xbox-cloud-gaming-now-looks-better-when-streamed-through-microsoft-edge-dev
Microsoft Edge Dev recently gained support for Clarity Boost for Xbox Cloud Gaming. The feature enhances the sharpness and level of detail when playing games...
xbox cloud gaminglooksbetterstreamedmicrosoft
https://dev.to/lightningdev123/top-tools-for-managing-multi-cloud-environments-34g2
Managing cloud infrastructure used to mean choosing one provider and learning its ecosystem deeply.... Tagged with webdev, ai, cloudcomputing, productivity.
top toolsmulti clouddev communitymanagingenvironments
https://dev.to/gde/mcp-development-with-swift-firestore-cloud-run-and-gemini-cli-13ik
Jan 15, 2026 - Leveraging Gemini CLI and the underlying Gemini LLM to build Model Context Protocol (MCP) AI... Tagged with firestore, googlecloudrun, agents, gemini.
mcp developmentcloud rungemini cliswiftfirestore
https://dev.to/aws-builders/containers-in-the-cloud-g8o
ECS - Elastic Container service ECS is container orchestration service ECS helps to run... Tagged with aws, containerapps, eks, fargate.
cloud devcontainerscommunity
https://dev.to/aws-builders/what-cloud-has-to-offer-to-life-science-serverless-3992
Introduction As you delve deeper into coding and your code becomes too heavy to run on... Tagged with serverless, aws, lifescience.
life sciencecloudofferserverlessdev
https://dev.to/devteam/you-can-now-embed-cloud-run-deployments-directly-in-your-dev-posts-1jk8
We're excited to announce that you can now showcase your Google AI projects with a dedicated Cloud... Tagged with cloud, news, devto, forem.
cloud runembeddeploymentsdirectly
https://dev.to/scc33/welcome-to-cloud-computing-4o22
Embarking on a Journey Through the Cloud: Exploring the Technologies, Services, and Innovations... Tagged with cloud, cloudcomputing, blogging.
cloud computingdev communitywelcome
https://www.bleepingcomputer.com/news/security/goto-says-hackers-breached-its-dev-environment-cloud-storage/
Remote access and collaboration company GoTo disclosed today that they suffered a security breach where threat actors gained access to their development...
dev environmentcloud storagegotosayshackers
https://dev.to/devsatasurion/building-a-multi-region-highly-available-identity-provider-with-the-aws-cloud-and-ory-hydra-5c5e
AsurionID is an OpenID Connect (OIDC) compatible identity provider. It allows Asurion developers to... Tagged with aws, resiliency, cloudskills,...
identity providerbuildingmultiregionhighly
https://dev.to/aws-builders/stop-organizing-scavenger-hunts-in-your-cloud-infrastructure-1m9c
A CloudWatch alarm is triggered. Now what? I am not the first person to tell you that observability... Tagged with cloudwatch, observability, scavengerhunt,...
scavenger huntscloud infrastructuredev communitystoporganizing
https://dev.to/tooljet/building-a-google-cloud-storage-gcs-file-explorer-app-in-30-minutes-4ck4
In this tutorial, we will build an internal tool for reading, downloading and uploading files to the... Tagged with showdev, webdev, programming, opensource.
google cloud storagefile explorerbuildinggcsapp
https://www.okteto.com/
Fast, flexible Kubernetes development environments. Okteto helps teams ship faster with automated, ephemeral environments that scale with your team.
cloud devshipfasterflexibleautomated
https://dev.to/maame-codes/the-broke-students-guide-to-the-cloud-how-i-host-projects-for-0-2iok
Dec 17, 2025 - Let’s be real. The scariest part of computer science isn't reversing a binary tree on a... Tagged with devops, beginners, finops, aws.
brokeguidecloudhost
https://dev.to/mozes721/effortlessly-deploy-your-gcp-cloud-run-app-using-terraform-22mb
Terraform is gaining more popularity for a reason as it provides high level of control flexibility... Tagged with go, terraform, devops, googlecloud.
cloud runeffortlesslydeploygcpapp
https://dev.to/rmoff/creating-an-http-source-connector-on-confluent-cloud-from-the-cli-31i4
In this blog article I'll show you how you can use the confluent CLI to set up a Kafka cluster on... Tagged with apachekafka, restapi, confluent.
confluent cloudcreatinghttpsourceconnector
https://cloud.google.com/events/google-dev-cloud-day-zurich?utm_source=website&%3Butm_medium=blog&%3Butm_campaign=FY25-Q1-emea-EME31378-physicalevent-er-Google-dev-cloud-day-Zurich-Tango&%3Butm_content=google-dev-webcard&%3Butm_term=-&hl=tr
Reserve your seat for a day of technical talks and hands-on workshops to discover Gemini 2.0 and get practical experience with interactive labs design
googledevclouddayzurich
https://dev.to/tiamatt/quick-guide-to-pass-aws-certified-cloud-practitioner-certification-39od
Recently, I passed the AWS Certified Cloud Practitioner exam with a score of 905/1000. With limited c... Tagged with aws, cloud, certification.
certified cloud practitionerquick guidepassawsexam
https://dev.to/ankushsinghgandhi/warrioros-building-a-modern-terminal-portfolio-with-react-gemini-and-cloud-run-ehj
This is a submission for the New Year, New You Portfolio Challenge Presented by Google AI ... Tagged with devchallenge, googleaichallenge, portfolio, gemini.
buildingmodernterminalportfolioreact
https://dev.to/ibmdeveloper/deploy-a-containerized-node-js-app-to-ibm-cloud-foundry-588o
Welcome to back to THINK Days! In this hands-on tutorial, you will deploy a "Hello world" Node.js... Tagged with tutorial, node, cloud, docker.
ibm clouddev communitydeploycontainerizedapp
https://showroom.cloud/
Curated software tools, libraries, and web development resources for building modern cloud-native applications.
cloud devtool suiteshowroom
https://cloud.google.com/events/google-dev-cloud-day-warsaw?utm_source=website&utm_medium=blog&utm_campaign=FY25-Q1-emea-EME31658-physicalevent-er-Google-dev-cloud-day-Warsaw-Tango&utm_content=google-dev-webcard&utm_term=-&authuser=2
Reserve your seat for a day of technical talks and hands-on workshops to discover Gemini 2.0 and get practical experience with interactive labs
registergoogledevcloudday
https://dev.to/skillboosttrainer/top-10-google-cloud-platform-gcp-skills-of-2025-3ll6
Cloud computing is transforming businesses across the globe, and Google Cloud Platform (GCP) stands... Tagged with google, gcp, googlecloud, skills.
google cloud platformtopgcpskillsdev
https://hirefullstack.pro/
HireFullstack.pro connects businesses with verified IT professionals for Web Development, Digital Marketing, Odoo/ERPNext, AWS/Azure/GCP Cloud, AI Consultancy,...
pro connectweb devtopprofessionalscloud
https://www.theserverside.com/feature/Cloud-marketplace-as-a-service-creates-new-dev-possibilities
Sep 17, 2019 - A marketplace as a service could make it easier for developers to work across multiple cloud environments and shed lock-in concerns with one of the major cloud...
cloud marketplaceservicecreatesnewdev
https://dev.to/sravanibikkina/aws-cloud-computing-services-17jc
AWS Cloud computing services: Amazon Elastic Compute Cloud (Amazon EC2): EC2 is a web service that...
aws cloud computingdev communityservices
https://dev.to/jcderose/controlling-cloud-costs-with-culture-26jc
As companies move more workloads into public cloud platforms like AWS, GCP, and Azure, managing those... Tagged with aws, cloud, writing, management.
cloud costsdev communitycontrollingculture
https://dev.to/s3cloudhub/azure-portal-overview-the-gateway-to-cloud-excellence-4mei
An overview of Azure Portal, highlighting its features, benefits, and best practices for cloud management. Tagged with azure, cloud, devops, microsoft.
azure portaldev communityoverviewgatewaycloud
https://dev.to/cookrdan/cloud-storage-that-ignores-nodemodules-with-an-ignore-file-376d
Ignore node_modules with a filter file using Tresorit cloud storage. Tagged with node, npm, cloudstorage.
cloud storageignoresnodemodulesfilter
https://cloud.google.com/events/google-dev-cloud-day-zurich?utm_source=website&%3Butm_medium=blog&%3Butm_campaign=FY25-Q1-emea-EME31378-physicalevent-er-Google-dev-cloud-day-Zurich-Tango&%3Butm_content=google-dev-webcard&%3Butm_term=-&authuser=0&hl=zh-tw
Reserve your seat for a day of technical talks and hands-on workshops to discover Gemini 2.0 and get practical experience with interactive labs design
googledevclouddayzurich
https://dev.to/swlkr/day-14-swift-macos-password-manager-for-people-who-hate-the-cloud-4m5d
Watch as I make a password manager for macOS this month. Tagged with macos, swift, passwordmanager, cloud.
password managerdayswiftmacospeople
https://dev.to/googlecloud/ai-appraiser-discover-the-value-of-your-items-with-gemini-on-google-cloud-n4p
While you were out shopping or cleaning up around the house, have you ever wondered what an item is... Tagged with googlecloudplatform, gemini,...
aidiscovervalueitemsgemini
https://dev.to/davidharcombe/increasing-your-cloud-function-development-velocity-using-dynamically-loading-python-classes-4fm3
One of the issues developers can encounter when developing in Cloud Functions is the time taken to... Tagged with python, programming, cloud.
development velocityincreasingcloudfunctionusing
https://dev.to/sknaresh2000/my-experience-with-cloud-resume-challenge-cc
Hello everyone. This is my first post and I would like to share my experience with cloud resume chall... Tagged with aws, challenge, serverless.
dev communityexperiencecloudresumechallenge