Robuta

https://marketplace.microsoft.com/en-us/marketplace/apps?page=1&industry=healthcare&culture=en-us&country=us
Accelerate your AI transformation with Microsoft Marketplace—your trusted source to find, try, and buy cloud solutions, AI apps, and agents to meet your...
microsoft marketplacecloud solutionsai appsagents
https://www.pax8.com/en-us/marketplace/
Dec 9, 2025 - The Pax8 Marketplace redefines how partners manage their business with powerful tools to discover opportunities, design solutions and directly engage customers.
cloud productsbrowsehundredsleadingmarketplace
https://plugins.jetbrains.com/plugin/8079-google-cloud-code
Use Google Cloud Code right from your IDE to build applications and integrate with GCP services faster and easier. Cloud Code helps you increase agility and...
google cloudcodeintellijidesplugin
https://www.cudocompute.com/blog/sustainability-meets-innovation
May 16, 2023 - Learn how CUDO Compute's cloud marketplace represents an innovative approach towards meeting today's market challenges.
cloud marketplacesustainabilitymeetsinnovationcompute
https://marketplace.visualstudio.com/items?itemName=GoogleCloudTools.cloudcode
Extension for Visual Studio Code - Tools for Google Cloud
visual studio marketplacegoogle cloudcode
https://www.pax8.com/fr-fr/
Dec 1, 2025 - Pax8 est la Marketplace leader qui aide chaque petite entreprise à réaliser ses rêves grâce à la puissance de la technologie pilotée par l'IA, de la...
laclouddeemeafr
https://www.clever.cloud/marketplace/
Sep 5, 2025 - Add‑ons to power your applications.
clever cloudmarketplace
https://marketplace.microsoft.com/en-us/marketplace/apps?product=office&page=1&src=office&corrid=a56eb2ca-90db-99d4-2c1b-26f4b560a271&omexanonuid=&referralurl=
Discover the Office app for your business needs. Explore a diverse range of Word , Excel, PowerPoint, Outlook, Teams, and SharePoint plugins. Whether you are...
microsoft marketplacecloud solutionsai appsagents
https://www.pax8.com/en-us/
Nov 18, 2025 - Pax8 is the leading Marketplace that helps every small business turn their dreams into reality through the power of AI-driven technology, community and...
cloud marketplaceoneinfinitegrowth
https://marketplace.microsoft.com/en-ph/marketplace/partner-dir/b16e6c57-2a05-4527-9210-ddb885add7d4/overview
microsoft marketplacecloud solutionsai appsagents
https://itdigest.com/cloud-computing-mobility/cloud-security/vercaras-cloud-security-now-on-aws-marketplace/
Aug 14, 2024 - Vercara, a leading provider of cloud-based services that secure the online experience, announced today that its core domain name system
cloud securityaws marketplace
https://marketplace.microsoft.com/en-us/marketplace/partner-dir?filter=sort%3D0%3BpageSize%3D18%3BonlyThisCountry%3Dtrue%3Bcountry%3DUS%3Blocname%3DUnited%2520States%3BlocationNotRequired%3Dtrue
microsoft marketplacecloud solutionsai appsagents
https://www.cloudblue.com/resources/cloud-marketplace-guide-2025/
Apr 21, 2025 - Download the CloudBlue Cloud Marketplace Guide 2025 to explore key trends, AI-driven growth, monetization strategies, and more.
cloud marketplaceguide
https://www.pax8.com/en-uk/
Nov 18, 2025 - Pax8 is the leading Marketplace that helps every small business turn their dreams into reality through the power of AI-driven technology, community and...
cloud marketplaceuk
https://appexchange.salesforce.com/
AppExchange: Extend Salesforce with AI-powered apps. Find ready-to-install solutions and consultants for every business need.
salesforce appexchangeenterprise cloudleadingmarketplace
https://marketplace.alibabacloud.com/
Alibaba Cloud provides industry solutions to our global customers.
alibaba cloudmarketplacepowerdrivedream
https://marketplace.brightcove.com/partners/wochit-video-editor
Jan 15, 2025 - Simplify your video production process, maintain brand consistency, and achieve a broader content reach with Wochit Studio. This integration offers...
video editingcloudbasedorganizationsbrightcove
https://marketplace.microsoft.com/sr-latn-rs/marketplace/apps?corrid=31391766-1f9c-25bf-c7be-26e2f52e79aa&page=1&product=office&src=office
Discover the Office app for your business needs. Explore a diverse range of Word , Excel, PowerPoint, Outlook, Teams, and SharePoint plugins. Whether you are...
microsoft marketplacecloud solutionsai appsagents
https://marketplace.brightcove.com/t/categories/Content%20Distribution%20&%20Storage/cloud-storage
cloud storagebrightcovemarketplace
https://www.computerweekly.com/news/366632577/ATT-Ericsson-launch-cloud-based-IoT-marketplace
Oct 10, 2025 - Marketplace hosted on Microsoft Azure developed by leading comms provider and comms tech company designed to simplify selling, contracting, provisioning and...
ampericssonlaunchcloudbased
https://www.pax8.com/en-eu/
Nov 18, 2025 - Pax8 is the leading Marketplace that helps every small business turn their dreams into reality through the power of AI-driven technology, community and...
cloud marketplaceemeaen
https://futurumgroup.com/research-reports/scaling-smarter-how-google-cloud-marketplace-is-reshaping-partner-sales-and-gtm-strategy/
Oct 21, 2025 - Shift your strategy—get a copy of Scaling Smarter: How Google Cloud Marketplace Is Reshaping Partner Sales and GTM Strategy today.
google cloud marketplacereshapingpartnergtmstrategy
https://airtable.com/marketplace/blkpPq3gFW517NxMh/jira
Import your Jira tasks and epics. on Airtable with the Jira Cloud app.
jira cloudappsairtablemarketplace
https://www.westconcomstor.com/au/en/services/aws-marketplace.html
Grow revenue, and close faster—partner with Westcon & AWS Marketplace to unlock new deals and simplify purchasing. Start today!
aws marketplaceunleashcloudpotential
https://www.hycu.com/solutions/marketplace
Explore HYCU's world of purpose-built workloads and start protecting your entire organization today.
cloud marketplacehycu
https://newsroom.cancom.com/news/cancom-integrates-stackits-sovereign-cloud-services-into-the-cloud-marketplace
Nov 25, 2025 - The entire STACKIT cloud portfolio is now available via the CANCOM Cloud Marketplace. This gives companies, organizations, and public sector clients access to...
sovereign cloudcancomintegratesstackitservices
https://neoncloud.com/marketplace/
May 22, 2025 - Elevate your digital commerce with Neon Cloud Marketplace Solutions to get seamless integrations, AI-driven insights, and scalable growth for businesses.
cloud marketplaceneonsmartampscalable
https://www.channeldive.com/news/cloud-marketplace-sales-skyrocket-infrastructure-software-ai/802991/
Multiyear enterprise cloud commitments will lead software sales to increase more than fivefold in the next five years, according to Omdia.
cloud marketplacechannel divesalessetskyrocket
https://www.appsflyer.com/blog/ceo/ai-privacy-data-collaboration/
Oren Kaniel discusses how to solve the AI / data privacy paradox, the future of private data collaboration.
data privacycloud marketplaceaiparadoxannouncing
https://marketplace.microsoft.com/en-us/
Accelerate your AI transformation with Microsoft Marketplace—your trusted source to find, try, and buy cloud solutions, AI apps, and agents to meet your...
microsoft marketplacecloud solutionsai appsagents
https://www.3cx.es/docs/pbx-google-cloud-marketplace/
Mar 9, 2025 - Esta guía le llevará a través de los pasos requeridos para hospedar su PBX 3CX en Google Cloud marketplace. Lea más.
google cloud marketplacesupbxen
https://aimeos.org/b2b-ecommerce
Build complex B2B e-commerce platforms, B2B marketplaces and custom B2B multi-brand portals using the cloud-native, ultra fast Aimeos eCommerce platform
ecommerce platformcloud nativegtmarketplaceamp
https://www.pax8.com/en-au/
Dec 3, 2025 - Pax8 is the leading Marketplace that helps every small business turn their dreams into reality through the power of AI-driven technology, community and...
cloud marketplaceau
https://solutions.acronis.com/en-us/integrations/rectron-cloud-marketplace/
Rectron cloud marketplace automates and makes it easy for service providers to purchase, deliver and manage cloud services for customers of all sizes.
cloud marketplace
https://www.theserverside.com/feature/Cloud-marketplace-as-a-service-creates-new-dev-possibilities
Sep 17, 2019 - A marketplace as a service could make it easier for developers to work across multiple cloud environments and shed lock-in concerns with one of the major cloud...
cloud marketplaceservicecreatesnewdev
https://marketplace.visualstudio.com/publishers/GoogleCloudTools
visual studio marketplacegoogle cloudpublisher
https://www.shadeform.ai/
Efficiently develop, train, and deploy AI models in any cloud environment. Access on-demand GPUs across multiple GPU clouds and seamlessly scale ML inference...
cloud marketplacegpu
https://marketplace.microsoft.com/en-us?icid=DSM_AllCommercial_Marketplace&ocid=cmm3c8ee9bs
Accelerate your AI transformation with Microsoft Marketplace—your trusted source to find, try, and buy cloud solutions, AI apps, and agents to meet your...
microsoft marketplacecloud solutionsai appsagents
https://www.pax8.com/en-apac/
Nov 18, 2025 - Pax8 is the leading Marketplace that helps every small business turn their dreams into reality through the power of AI-driven technology, community and...
cloud marketplaceapac
https://infiterra.com/white-label-cloud-marketplace/
Launch a white-label cloud marketplace to sell SaaS and cloud services. Automate provisioning, subscriptions and managed marketplace operations.
white labelcloud marketplaceplatform
https://marketplace.huaweicloud.com/intl/sellercenter/
huawei cloudsellerregistrationmarketplace
https://marketplace.microsoft.com/en-us/product/WA200008645?tab=Overview
microsoft marketplacecloud solutionsai appsagents
https://marketplace.microsoft.com/en-us/marketplace/apps?industry=manufacturing-resources&page=1&subindustries=automotive&culture=en-us&country=us
Accelerate your AI transformation with Microsoft Marketplace—your trusted source to find, try, and buy cloud solutions, AI apps, and agents to meet your...
microsoft marketplacecloud solutionsai appsagents