https://saviynt.com/blog/saviynt-joins-aws-ai-agent-marketplace-as-launch-partner-with-new-mcp-server-available-today
Saviynt named a launch partner for AWS’ new AI Agents and Tools Category on AWS Marketplace, debuting its new MCP Server.
ai agentsaviyntnamedawsmarketplace
https://training.linuxfoundation.org/awsmarketplace/
Oct 29, 2025 - Find us in the AWS Marketplace! Easily and quickly purchase Linux Foundation courses and certification exams.
aws marketplacelinux foundationeducation
https://vercel.com/kb/guide/connect-next-js-to-aws-aurora-postgresql-using-vercel-marketplace
Learn how to connect your Next.js application to AWS Aurora PostgreSQL securely using the Vercel Marketplace AWS integration
next jsaws auroravercel marketplaceconnectpostgresql
https://lokalise.com/aws/
Sep 1, 2025 - Accelerate global expansion with centralized and automated localization on AWS Marketplace, and increase stakeholder visibility and efficiency throughout the...
aws marketplacelokaliselaunches
https://www.eurotech.com/news/everyware-greenedge-now-on-aws-marketplace/
Jul 30, 2024 - Everyware GreenEdge now on AWS Marketplace - Unleashing the power of the edge
aws marketplaceeurotech
https://www.skyflow.com/partners/aws
Skyflow allows you to protect, govern, and use sensitive data, no matter where it lives in your organization. Eliminate sensitive data sprawl from your...
amazon web servicesaws marketplace
https://itdigest.com/cloud-computing-mobility/cloud-security/vercaras-cloud-security-now-on-aws-marketplace/
Aug 14, 2024 - Vercara, a leading provider of cloud-based services that secure the online experience, announced today that its core domain name system
cloud securityaws marketplace
https://stripo.email/blog/stripo-joins-aws-marketplace-easier-access-for-enterprise-teams/
Dec 12, 2025 - Learn how you can purchase and use Stripo in the AWS Marketplace to make it easier for enterprise teams to deploy, manage, and use our email design platform.
aws marketplaceenterprise teamsjoinseasieraccess
https://www.razer.com/newsroom/company-news/razer-qa-companion-available-on-aws-marketplace/
Dec 22, 2025 - Razer™, the leading global lifestyle brand for gamers, today announced the official availability of Razer QA Co-AI on AWS Marketplace
aws marketplacerazerqacoai
https://marketplace.atlassian.com/apps/1210933/draw-io-diagrams-for-confluence?hosting=cloud&tab=overview
Create secure, user-friendly diagrams with the top-rated diagramming solution since 2013 and one of the first major apps on Forge
drawiodiagramsumlbpmn
https://www.constellationr.com/media/scaling-ai-innovation-globally-datamasques-journey-synthetic-data-and-aws-marketplace
We are LIVE from the Amazon Web Services (AWS) Startup Partner Summit. R "Ray" Wang and Bob O'Donnell sat down with Grant de Leeuw, CEO &...
scaling aisynthetic datainnovationgloballyjourney
https://winbuzzer.com/2025/07/11/aws-to-launch-ai-agent-marketplace-with-anthropic-stepping-up-rivalry-with-google-and-microsoft-xcxwbn/
Jul 11, 2025 - AWS is launching its AI agent marketplace with partner Anthropic, directly challenging Google and Microsoft.
ai agentawslaunchmarketplaceanthropic
https://www.techpartner.news/news/zoom-plans-aws-marketplace-launch-msp-focus-for-australia-621762
Zoom is planning to make its products available on the AWS Marketplace in Australia and is looking to work with more managed services providers.
aws marketplacezoomplanslaunchmsp
https://aws.amazon.com/marketplace/pp/prodview-pp445qepfdy34?trk=a0273619-f6ca-40ef-aa7e-571da2f8ab6f&sc_channel=el
Trusted by global brands, MongoDB Atlas on AWS is a deeply integrated data platform that powers scaled, enterprise level AI applications across various...
aws marketplacemongodb atlaspay
https://www.westconcomstor.com/au/en/services/aws-marketplace.html
Grow revenue, and close faster—partner with Westcon & AWS Marketplace to unlock new deals and simplify purchasing. Start today!
aws marketplaceunleashcloudpotential
https://winbuzzer.com/2025/07/16/aws-heats-up-ai-agent-arms-race-with-new-agentcore-platform-and-marketplace-xcxwbn/
Jul 16, 2025 - AWS launches Amazon Bedrock AgentCore and an AI agent marketplace, escalating its rivalry with Google and Microsoft in the race for enterprise AI agent...
ai agentarms raceawsheatsnew
https://www.wolterskluwer.com/ja-jp/news/pr-2025-cch-tagetik-intelligent-platform-available-as-private-offer-in-aws-marketplace
Nov 3, 2025 - ウォルターズ・クルワー は2025年11月3日、CCH® Tagetik Intelligent Platformが AWS Marketplace...
aws marketplacecchintelligent
https://www.amd.com/en/resources/case-studies/opensooq.html
OpenSooq achieves cost-efficient, higher performance infrastructure for the online classifieds marketplace by deploying on AMD-powered AWS instances.
scalesmarketplaceawsamd
https://brainboxai.com/en/newsroom/brainbox-ai-announces-its-availability-in-aws-marketplace
BrainBox AI announces availability in AWS Marketplace, offering cutting-edge AI solutions for sustainable building management.
aws marketplaceaiannounces
https://securitybrief.co.uk/story/westcon-comstor-brings-proofpoint-to-aws-marketplace-for-europe
Westcon-Comstor now offers Proofpoint security solutions to European partners via AWS Marketplace, simplifying access to advanced cybersecurity in the region.
aws marketplacebringsproofpointeurope
https://pages.peerspot.com/aws-marketplace-reviews
PeerSpot powers AWS Marketplace reviews—helping sellers boost star ratings, increase trust, and drive growth. Start your review strategy.
aws marketplacegetreviews
https://blog.detectify.com/news/detectify-is-now-available-on-aws-marketplace/
Apr 22, 2024 - Detectify External Attack Surface Management (EASM) solution is now available on AWS Marketplace through private offer.
aws marketplacedetectifyavailableblog
https://brave.com/blog/search-api-aws-marketplace/
Brave Search API available in the new AI Agents and Tools category of AWS Marketplace, providing real-time Web data for AI, LLMs, and search applications.
search apibravesoftwareannouncesavailability
https://bfore.ai/aws-marketplace/
Dec 11, 2025 - AWS Marketplace provides customers with a trusted ecosystem for procurement and billing, without the usual hassle of layers of approvals and back-and-forth
aws marketplace
https://www.itential.com/aws-marketplace/
Oct 29, 2025 - Explore our listings, request custom private offers, and simplify purchasing through your AWS account.
aws marketplacediscover
https://www.techtarget.com/searchitchannel/news/366627818/Consultants-SIs-back-AWS-agentic-AI-marketplace-launch
Jul 16, 2025 - Several consultants and systems integrators are part of the AWS agentic AI marketplace launch. Read about this development.
agentic aiconsultantssisbackaws
https://pages.awscloud.com/unified-aws-observability-grafana-in-aws-marketplace.html?trk=6fa9ce01-21e8-4b88-a94e-bec476ec841e&sc_channel=display+ads
metricslogstracedataaws
https://vercel.com/blog/aws-databases-are-now-live-on-the-vercel-marketplace-and-v0
v0 can now provision AWS databases as it builds your app. Aurora PostgreSQL, DynamoDB, and Aurora DSQL available in the Vercel Marketplace.
vercel marketplaceawsdatabaseslive
https://seerist.com/press-release/seerist-now-available-in-aws-marketplace-simplifying-access-to-enterprise-risk-intelligence/
Nov 4, 2025 - Now on AWS Marketplace—Seerist lets organizations easily add advanced risk intelligence to their AWS infrastructure
aws marketplaceavailableaccessenterprise
https://aws.amazon.com/marketplace/?nc2=h_utmp
Discover, purchase, migrate and deploy software solutions on AWS. Get the business software you want in minutes and pay only for what you consume.
aws marketplacehomepage
https://www.protera.com/resource-center/proteras-digital-transformation-services-now-available-through-aws-cloud-marketplace
Protera's Digital Transformation Services Now Available Through AWS Cloud Marketplace
digital transformationaws cloudservicesavailable