Robuta

https://complianz.io/legal/privacy-statement/ Privacy statement - Complianz Aug 18, 2025 - This privacy statement was last updated on September 12, 2024 and applies to citizens and legal permanent residents of the European Economic Area and... privacy statementcomplianz https://complianz.io/ 1 Million Users Trust Complianz for WordPress & Shopify Consent for wordpressmillionuserstrustcomplianz https://wordpress.org/plugins/complianz-gdpr/ Complianz – GDPR/CCPA Cookie Consent – WordPress plugin | WordPress.org Jul 24, 2026 - Configure your Cookie Banner, Cookie Consent and Cookie Policy with our Wizard and Cookies Scan. cookie consentwordpress plugincomplianzgdprccpa https://complianz.io/documentation/integrations/ Integrations - Complianz integrationscomplianz https://complianz.io/translate-legal-documents-to-multiple-languages-with-translatepress/ Translate legal documents to multiple languages with TranslatePress - Complianz Mar 11, 2026 - TranslatePress is one of the most popular translation plugins available for WordPress. Complianz works hand in hand with TranslatePress, to ensure smooth... legal documentsmultiple languagestranslatecomplianz https://complianz.io/pricing/? Complianz - Pricing May 13, 2026 - In collaboration with lawyers and Really Simple SSL. The Complianz Wordpress GDPR Plugin is the base for every Wordpress website. complianzpricing https://complianz.io/upgrading-free-to-premium/ How to upgrade from Free to Premium? - Complianz Sep 25, 2024 - You have decided to upgrade from Free to Premium but don’t know how to do this. Follow the instructions in this article and we will help make you GDPR ready!... how to upgradefrom freepremiumcomplianz https://complianz.io/css-lesson-12-apply-properties-based-on-consent-type-region/ CSS Lesson #12: Apply properties based on Consent Type & Region - Complianz Mar 13, 2026 - When GEO IP is enabled in Complianz, the type of Cookie Banner shown to the visitor (opt-in/opt-out) will depend on the location from which a user visits your... based oncsslessonapplyproperties https://complianz.io/legal/privacy-statement-us/?tid=312819531 Privacy statement (US) - Complianz privacy statementuscomplianz https://complianz.io/affiliate-login/ Affiliate Login - Complianz Nov 25, 2024 - Affiliates Join 1 Million users and install The Privacy Suite for WordPress locally, automated or fully customized, and access our awesome support if you need... affiliate logincomplianz https://complianz.io/2023/08/17/ August 17, 2023 - Complianz augustcomplianz https://complianz.link/ COMPLIANZ.LINK - A Dub Custom Domain | Dub COMPLIANZ.LINK is a custom domain on Dub - the modern link attribution platform for short links, conversion tracking, and affiliate programs. link acomplianzdubcustomdomain https://elementor.com/blog/complianz-altern/ 10 Best Complianz Alternative 2026 in 2026 Apr 23, 2026 - Finding the best complianz alternative 2026 requires more than just picking a free plugin and hoping for the best. Privacy laws mutated aggressively over the... bestcomplianzalternative https://complianz.io/fix-404-errors-caused-by-complianz-css-files-in-seo-plugins/ Fix 404 Errors Caused by Complianz CSS Files in SEO Plugins - Complianz Jun 24, 2026 - Stop false 404 errors from Complianz dynamic CSS files. Three fixes for Rank Math, SEOPress and any SEO plugin using robots.txt or a quick exclusion. css filesfixerrorscaused https://complianz.io/css-lesson-27-arranging-your-logo-title-and-close-button-on-mobile/ CSS Lesson #27: Arranging your Logo, Title and Close Button on Mobile - Complianz Mar 7, 2023 - The header of the Cookie Banner can contain 3 elements: A logo A banner title A close button As you can see in the image, the banner title is gone when you... https://complianz.io/privacy-statement/ Privacy statement - Complianz Aug 18, 2025 - This privacy statement was last updated on September 12, 2024 and applies to citizens and legal permanent residents of the European Economic Area and... privacy statementcomplianz https://elementor.com/blog/10-best-onetrust-vs-complianz-2026/ 10 Best Onetrust Vs Complianz in 2026 Apr 24, 2026 - Choosing between OneTrust and Complianz usually means you're stuck between enterprise bloat and complex plugin settings. In 2026, website owners need strict... bestonetrustvscomplianz https://complianz.io/google-tag-gateway/ Google Tag Gateway - Complianz On this page What Google Tag Gateway is, and how it affects consent How to verify whether a tag is enrolled in GTG What a late consent signal looks like If a... google tag gatewaycomplianz https://complianz.io/legal/privacy-statement-us/?tid=137891912 Privacy statement (US) - Complianz privacy statementuscomplianz https://complianz.io/definition/ Definitions Archive - Complianz definitionsarchivecomplianz https://wordpress.org/support/plugin/complianz-gdpr/active/ [Complianz - GDPR/CCPA Cookie Consent] Recent Activity | WordPress.org cookie consentrecent activitycomplianzgdprccpa https://complianz.io/change-the-recipient-of-data-requests/ Change the recipient of Data Requests - Complianz Oct 23, 2025 - Complianz Premium inserts a Data Request Form in your Privacy Statement, allowing data subjects to submit a variety of requests concerning their personal data.... data requestschangerecipientcomplianz https://complianz.io/2021/01/25/ January 25, 2021 - Complianz januarycomplianz https://complianz.io/why-the-wp-consent-api-is-important-a-case-study-with-cf7-and-recaptcha/ Contact Form 7 version 5.4 onward no longer viable for integrations - Complianz Mar 11, 2026 - How to integrate the WP Consent API with Contact Form 7? Instructions can be found here. Due to the newest update from CF7, we cannot integrate with CF7 and... https://complianz.io/exclude-from-cookie-scan-blocker-or-banner/ Exclude Pages from the Scan, Cookie Blocker or Cookie Banner - Complianz Mar 14, 2023 - There are cases imaginable where you want to exclude a certain page from the Cookie Scan, so that cookies set on that page will not be discovered during the... from theexcludepagesscancookie https://complianz.io/2022/02/09/ February 9, 2022 - Complianz februarycomplianz https://complianz.io/wcag-contrast-checker-in-complianz-cookie-banner-settings/ WCAG contrast checker in Complianz cookie banner settings - Complianz Dec 19, 2025 - To help you meet accessibility standards, the Complianz WordPress plugin now includes a built-in WCAG contrast checker. This tool helps you make sure your... wcag contrast checkercookie bannercomplianzsettings https://complianz.io/legal/privacy-statement-za/ Privacy Statement (ZA) - Complianz privacy statementzacomplianz https://complianz.io/statistics-implementation/ Statistics Configuration in the Wizard - Complianz Oct 8, 2025 - The Statistics section of the Complianz wizard helps you decide how to handle analytics and tracking tools on your site. Complianz will then add the correct... in thestatisticsconfigurationwizardcomplianz https://support.google.com/google-ads/answer/14563380?hl=en&ref_topic=14226291 Set up Complianz to obtain user consent - Google Ads Help To capture valuable insights while protecting user privacy, you need to collect consent from your website users. We recommend you use a Consent Management... set upuser consentgoogle adscomplianzobtain https://complianz.io/2025/07/18/ - Complianz complianz https://complianz.io/tag/mu-plugins/ MU Plugins - Complianz mupluginscomplianz https://complianz.io/css-lesson-20-bringing-the-cookie-banner-title-back-to-mobile/ CSS Lesson #20: Bringing the Cookie Banner title back to Mobile - Complianz Jan 18, 2022 - You might have noticed Complianz removed the Cookie Banner title on mobile devices. The reason is that the Cookie Banner title is the widest element on mobile... the cookie https://complianz.io/toll-free-phone-number-ccpa/ Toll free phone numbers and the CCPA (Update) - Complianz Mar 6, 2026 - In January 2020 the CCPA came into force. In this article, we discuss toll-free phone numbers. Toll-Free Phone Numbers The CCPA requires companies to set up... free phone numbersand thetollccpaupdate https://complianz.io/legal/privacy-statement-us/?tid=331704372095 Privacy statement (US) - Complianz privacy statementuscomplianz https://complianz.io/where-to-find-and-manage-invoices/ Where to find and how to manage invoices - Complianz Jul 1, 2025 - Where to find your invoices Immediately after each payment or renewal, Complianz automatically generates your invoice and sends it to the email address used to... where to findmanage invoicescomplianz https://complianz.io/using-exceptions-in-tag-manager-based-on-consent-status/ Using exceptions in Tag Manager based on consent status - Complianz Mar 13, 2026 - In our article, The Definitive Guide to Tag Manager, we explained how to use custom events to trigger your tags based on the categories on your banner. In some... in tagbased onusingexceptionsmanager https://elementor.com/blog/ultimate-cookiez-vs-complianz-guide-2026/ The Ultimate Cookiez Vs Complianz Guide for 2026 Apr 30, 2026 - Look, getting cookie consent right in 2026 isn't just a legal box to check. It's a core part of your website's user experience. You've got strict data privacy... the ultimatevscomplianzguide https://fr.matomo.org/faq/tag-manager/integrate-complianz-for-wordpress-cmp-with-matomo-tag-manager/ How to integrate Complianz for WordPress CMP with Matomo Tag Manager FAQ - Analytics Platform -... how to integrate https://complianz.io/hook-a-function-or-method-to-a-specific-filter-action/ Adding functionalities in functions.php - Complianz Mar 5, 2026 - A quick introduction WordPress offers filter hooks to allow plugins to modify various types of internal data at runtime. A plugin can modify data by binding a... addingfunctionalitiesfunctionsphpcomplianz https://termly.io/resources/compare/termly-vs-complianz/ Termly vs Complianz: Comparing Features and Services Mar 26, 2026 - Compare Termly vs. Complianz to determine which solution offers the ideal privacy compliance tools for your business. termlyvscomplianzcomparingfeatures https://complianz.io/new-iab-tcf-requirements-and-google-cmp-certification/ New IAB TCF requirements and Google CMP Certification - Complianz Sep 8, 2023 - The coming months will revolve around new specifications by IAB Europe for TCF V2.2 in response to the Belgian Data Protection Authority and Google’s... iab tcfcmp certificationnewrequirementsgoogle https://complianz.io/legal/ Legal - Complianz Jan 22, 2026 - Legal Hub Join 1 million users and install The Privacy Suite for WordPress locally, automated or fully customized, and access our awesome support if you need... legalcomplianz https://complianz.io/legal/cookie-policy/?cmplz_region_redirect=true Cookie policy - Complianz cookie policycomplianz https://complianz.io/2023/06/27/ June 27, 2023 - Complianz junecomplianz https://complianz.io/affiliate-area/ Affiliate Area | Complianz Jun 13, 2025 - Affiliate Dashboard Join 1 Million users and install The Privacy Suite for WordPress locally, automated or fully customized, and access our awesome support if... affiliate areacomplianz https://complianz.io/2021/09/17/ - Complianz complianz https://complianz.io/records-of-consent/ Records of Consent - Complianz Aug 20, 2025 - Records of Consent, Data Requests, Statistics and more? records of consentcomplianz https://complianz.io/shopify/?_bt=BAh7BkkiC19yYWlscwY6BkVUewhJIglkYXRhBjsAVEkiEWNvbXBsaWFuei5pbwY7AEZJIghleHAGOwBUSSIdMjAyNS0wNy0xMlQwNzoxMjo1MS44MjJaBjsAVEkiCHB1cgY7AFRJIh5wZXJtYW5lbnRfcGFzc3dvcmRfYnlwYXNzBjsARg%3D%3D--b161738679c1f6f817e611441ff3af8ffd10d202 Shopify - Complianz Mar 12, 2026 - Take the guesswork out of privacy compliance Handle GDPR, CCPA, and global privacy laws with a quick, easy, and reliable Shopify app. Start Free Trial... shopifycomplianz https://complianz.io/wordpress-gdpr-solution/ Configure your Website for the GDPR with our WordPress Plugin - Complianz Mar 3, 2026 - While privacy legislation has been around for some time before 2018, the GDPR made us all realize that we should be aware of personal data and cookies used on... your websitefor thewordpress pluginconfigure https://complianz.io/configuring-for-polylang/ Configuring for Polylang - Complianz Mar 6, 2026 - Configuring Complianz for Polylang consists of 2 things; Adding policies for a new language Because shortcodes create our policies, the current languages from... configuringpolylangcomplianz https://complianz.io/configuring-recaptcha-and-consent-in-forminator/ Configuring reCAPTCHA and Consent in Forminator - Complianz Jun 13, 2022 - This guide explains how to configure Google reCAPTCHA in Forminator and manage consent with Complianz. This will result in a form that can only be sent once... configuringrecaptchaconsentforminatorcomplianz https://elementor.com/blog/termly-vs-compl/ 10 Best Termly Vs Complianz in 2026 Apr 24, 2026 - You're likely here because you need to make your website legal without destroying your design. Finding the right privacy tool is frustrating. Most consent... besttermlyvscomplianz https://complianz.io/2023/08/30/ August 30, 2023 - Complianz augustcomplianz https://complianz.io/embedding-vimeo-videos-privacy-friendly/ Embedding Vimeo videos privacy-friendly - Complianz Mar 7, 2023 - Hosting videos with a third-party service like YouTube or Vimeo is a great way to stream videos on your website, without carrying the server load for every... vimeo videosembeddingprivacyfriendlycomplianz https://complianz.io/shopify/?_bt=BAh7BkkiC19yYWlscwY6BkVUewhJIglkYXRhBjsAVEkiEWNvbXBsaWFuei5pbwY7AEZJIghleHAGOwBUSSIdMjAyNS0wNy0wOFQxMDozNTo0My42NDhaBjsAVEkiCHB1cgY7AFRJIh5wZXJtYW5lbnRfcGFzc3dvcmRfYnlwYXNzBjsARg%3D%3D--6e2906dbab2e02bdc15b9150499784d0e960fb8d Shopify - Complianz Mar 12, 2026 - Take the guesswork out of privacy compliance Handle GDPR, CCPA, and global privacy laws with a quick, easy, and reliable Shopify app. Start Free Trial... shopifycomplianz https://complianz.io/consent-on-scroll-or-time-out/ Consent on Scroll or Time Out - Complianz Mar 13, 2026 - Consent on Scroll or Time Out has long been the domain of Opt-out regions like the United States of America. Since the addition of Australia as a region, this... on scrolltime outconsentcomplianz https://complianz.io/shopify/pricing/come-back/ Complianz - Come Back Sep 16, 2025 - In collaboration with lawyers and Really Simple SSL. The Complianz Wordpress GDPR Plugin is the base for every Wordpress website. complianzcomeback https://complianz.io/errors-on-complianz-rest-api-troubleshooting-endpoint-exclusion/ Errors on Complianz REST API: Troubleshooting & Endpoint Exclusion - Complianz Mar 21, 2025 - On certain instances, some users have their REST API of their site voluntarily blocked. Complianz relies on the REST API in order to work properly, and in... rest apierrorscomplianztroubleshootingendpoint https://www.cookieyes.com/complianz-alternative/ Complianz Alternative - CookieYes Effortlessly manage cookie consent with CookieYes, the #1 Complianz alternative, trusted by over 1 million WordPress websites! complianzalternativecookieyes https://complianz.io/2020/07/11/ - Complianz complianz https://complianz.io/creating-the-legal-hub/ Creating the Legal Hub - Complianz Mar 6, 2026 - Have you seen our new Legal Hub? If not, have a look before reading this instruction article. We created the legal hub to centralize our legal documents and... legal hubcreatingcomplianz https://complianz.io/configuring-activecampaign/ Configuring ActiveCampaign - Complianz Apr 19, 2023 - Tracking with Active Campaign can be set-up in two different ways. You can use the official plugin by ActiveCampaign, or add the tracking script yourself,... configuringactivecampaigncomplianz https://complianz.io/license-for-staging-or-development-environments/ Licenses for staging or development environments - Complianz Mar 6, 2026 - Many website developers use a staging or localhost environment to build their website before publishing it. We frequently receive inquiries regarding whether... development environmentslicensesstagingcomplianz https://complianz.io/gutenberg/ Gutenberg: 2 Blocks and Feature requests - Complianz Mar 28, 2023 - With Gutenberg, or block editor entering Phase 3, Complianz is looking to expand in using the Block Editor with consent capabilities. The below blocks are... feature requestsgutenbergblockscomplianz https://complianz.io/legal/privacy-statement-ca/ Privacy statement (CA) - Complianz privacy statementcacomplianz https://complianz.io/shopify/?_bt=BAh7BkkiC19yYWlscwY6BkVUewhJIglkYXRhBjsAVEkiEWNvbXBsaWFuei5pbwY7AEZJIghleHAGOwBUSSIdMjAyNS0xMS0xOFQxNToxODowNS41MzRaBjsAVEkiCHB1cgY7AFRJIh5wZXJtYW5lbnRfcGFzc3dvcmRfYnlwYXNzBjsARg%3D%3D--874d0071bba159e447cd765a9d539eaa3a517c8a Shopify - Complianz Mar 12, 2026 - Take the guesswork out of privacy compliance Handle GDPR, CCPA, and global privacy laws with a quick, easy, and reliable Shopify app. Start Free Trial... shopifycomplianz https://complianz.io/changelog-complianz-premium/ Changelog Complianz Premium - Complianz Dec 23, 2025 - Looking for the changelog pages of the other versions? Complianz Premium Multisite Changelog Complianz Free Changelog changelogcomplianzpremium https://complianz.io/tag/manage-consent-button/ Manage Consent button - Complianz manage consentbuttoncomplianz https://complianz.io/updating-your-payment-method-or-renewal-failing/ Updating your payment method or renewal failing - Complianz May 5, 2025 - You can update your payment method via your account page, under subscriptions. The process of doing this slightly differs depending on if you are switching... your paymentupdatingmethodrenewalfailing https://elementor.com/blog/ultimate-complianz-vs-cookiez-guide-2026/ The Ultimate Complianz Vs Cookiez Guide for 2026 Apr 28, 2026 - Privacy isn't optional anymore. You already know this. But choosing between a local WordPress plugin and a cloud-based scanner feels like a massive gamble. the ultimatecomplianzvsguide https://complianz.io/how-to-set-google-tag-manager-after-consent-and-is-it-needed/ How to set Google Tag Manager after Consent (and is it needed?) - Complianz Mar 25, 2026 - Recent developments In March 2025, the German Administrative Court of Hanover (VG Hannover) ruled that loading Google Tag Manager (GTM) requires prior user... google tag manager https://complianz.io/shortcode-for-cookies/ Shortcode for Cookies - Complianz Mar 6, 2026 - How to use The new shortcode will show the cookie list, which is featured in all generated cookie policies from Complianz. We have received requests to add a... shortcodecookiescomplianz https://complianz.io/configuring-your-cookie-warning-step-by-step/ Configuring your cookie warning, step by step. - Complianz Mar 3, 2026 - Below we will go through the settings of the cookie banner, and explain the possibilities. General Appearance your cookieconfiguringwarningstepcomplianz https://complianz.io/does-complianz-affect-website-performance/ Does Complianz affect website performance? - Complianz Mar 5, 2026 - Update: Since 4.9.0, we have switched from admin requests to the REST API to improve performance and stability. If you want to know more about Web Vitals, read... complianzaffectperformance https://complianz.io/2025/04/21/ April 21, 2025 - Complianz aprilcomplianz https://wordpress.org/support/topic/great-plugin-36264/ Great plugin - [Complianz - GDPR/CCPA Cookie Consent] Review | WordPress.org Feb 25, 2023 - Great plugin Dafinka Hristova (@progres123) 3 years, 2 months ago Great plugin Viewing 1 replies (of 1 total) Thread Starter Dafinka Hristova (@progres123) 3... great plugincookie consentcomplianzgdprccpa https://complianz.io/accessibility-statement/ Accessibility statement - Complianz Jun 18, 2025 - Complianz B.V. is committed to ensuring digital accessibility for people with disabilities. This commitment extends to our website, WordPress plugin, and... accessibility statementcomplianz https://complianz.io/2024/08/27/ August 27, 2024 - Complianz augustcomplianz https://complianz.io/responding-to-a-data-request/ Responding to a Data Request - Complianz Mar 7, 2023 - Table of Contents What is the right of access? How do we recognize a subject access request (SAR)? What about requests for information about children? What... a datarespondingrequestcomplianz https://complianz.io/about-function-_load_textdomain_just_in_time-was-called-incorrectly/ About Function _load_textdomain_just_in_time was called incorrectly - Complianz Feb 19, 2026 - Notice: Function _load_textdomain_just_in_time was called incorrectly. Translation loading for the complianz-gdpr domain was triggered too early. This is... just in timefunctionload https://complianz.io/what-to-include-in-my-gdpr-cookie-banner/ What do I include in my GDPR cookie banner? - Complianz Dec 4, 2025 - If your business sells in Europe or targets people in the EU, you need to follow the General Data Protection Regulation, the GDPR. If your site uses... what dogdpr cookieincludebannercomplianz https://complianz.io/adding-data-request-forms-with-a-shortcode/ Adding Data Request Forms with a shortcode - Complianz Mar 7, 2023 - Complianz (version 6.2 and upwards) offers the possibility to insert Data Request Forms in your Legal Documents, allowing users/data subjects to submit... data request formsaddingshortcodecomplianz https://elementor.com/blog/cookieyes-vs-compl/ The Ultimate Cookieyes Vs Complianz Guide for 2026 Apr 26, 2026 - Privacy laws mutated aggressively in 2026. A simple text banner at the bottom of your website won't protect you from regulatory fines anymore. You need a... the ultimatecookieyesvscomplianzguide https://elementor.com/blog/complianz-alternative/ The Ultimate Best Complianz Alternative 2026 Guide for 2026 Apr 23, 2026 - Privacy compliance shouldn't mean sacrificing your site's design integrity. By tying native design tools directly into consent APIs, developers can create... the ultimate bestcomplianzalternativeguide https://complianz.io/pre-sale-questions-already-answered/ Pre-sale questions: already answered - Complianz pre sale questionsalreadyansweredcomplianz https://complianz.io/privacy-friendly-images-from-gravatar/ Privacy-Friendly Images from Gravatar - Complianz Mar 10, 2026 - WordPress core comes with a discussion functionality, as you can expect from a CMS that started with blogging as the main purpose. On every post, users can... privacyfriendlyimagesgravatarcomplianz https://complianz.io/tag/wordpress/ WordPress - Complianz wordpresscomplianz https://complianz.io/legal/cookie-policy/?cmplz_region_redirect=true&cmplz-region=eu Cookie policy - Complianz cookie policycomplianz https://wordpress.org/support/plugin/complianz-gdpr/reviews/?filter=4 [Complianz - GDPR/CCPA Cookie Consent] Reviews | WordPress.org cookie consentcomplianzgdprccpareviews https://complianz.io/are-legal-pages-considered-duplicate-content/ Are legal pages considered duplicate content? - Complianz Mar 13, 2026 - We often are asked if legal pages are duplicate content in the eyes of search engines. Users are worried that Google may give a penalty to pages with duplicate... legal pagesduplicate contentconsideredcomplianz https://complianz.vectortemplates.com/ 83 Verified Complianz Coupons - 20% Off | May 2026 May 13, 2026 - Save up to 20% with 83 verified Complianz coupons (May 2026). Hand-tested daily by our team. Start saving now! verifiedcomplianzcouponsmay