https://www.abs.gov.au/statistics/classifications/australian-standard-classification-education-asced/2001
Provides a basis for comparable administrative and statistical data on educational activities and attainment classified by level and field
australian standardclassificationeducationbureau
https://www.nationalacademies.org/projects/DBASSE-CNSTAT-20-08/about
The National Center for Education Statistics (NCES) is the primary federal entity charged to collect, collate, analyze, and report complete statistics on the...
education statisticsvisionroadmap
https://huebler.blogspot.com/
Analysis of international education statistics with a focus on Education for All (EFA) and the Millennium Development Goals (MDG).
international educationstatistics
https://www.oph.fi/en/datasets-and-analyses/statistics
The Finnish National Agency for Education produces, reports and analyses statistics related to education and internationalisation.
statisticsfinnishnationalagencyeducation
https://www.bestcolleges.com/research/women-in-higher-education-facts-statistics/
Women have higher rates of college enrollment, graduation, and student loan debt than men. Find data on women in higher education in our report.
higher educationkey factswomenstatisticsbestcolleges
https://www.fxempire.com/stocks/edu/profile
Dive into the New Oriental Education and Technology Group, Inc. - ADR (EDU) company profile. Key financial ratios, comprehensive company statistics, and...
new orientaltechnology groupeduincadr
https://boardofed.idaho.gov/data-research/statistics/
The Idaho State Board of Education makes policy for K-20 public education in Idaho, to create opportunity for lifelong attainment of high-quality education,...
idaho statestatisticsboardeducation
https://www.vitalsource.com/en-ca/products/xlstat-education-edition-for-anderson-david-r-sweeney-v9781337390439
XLSTAT Education Edition for Anderson/Sweeney/Williams/Camm/Cochran's Modern Business Statistics with Microsoft Office Excel, 7th Edition [Instant Access], 2...
education editionsweeney williamsxlstatandersoncamm
https://www.nationalacademies.org/read/26392/chapter/9
Read chapter 6 Summary of Recommendations: The education landscape in the United States has been changing rapidly in recent decades: student populations h...
education statisticsreadvisionroadmapnap
https://www.esri.com/partners/blue-raster-llc-a2T70000000TNM3EAO/national-center-for--a2df2000003emVQAAY
Blue Raster and the National Center for Education Statistics (NCES) EDGE Program believe that releasing this spatial data in an open, easy to use format is...
national centereducation statisticsedge programncesblue
https://www.abs.gov.au/statistics/classifications/osca-occupation-standard-classification-australia/2024-version-1-0/browse-classification/1/14/141
Plan, organise, direct, control and coordinate the provision of education, health, welfare and regulated children's education and care services and programs.
welfare serviceminorgroupeducationhealth
https://www.education.gov.au/higher-education-statistics/staff-data/selected-higher-education-statistics-2014-staff-data
The Higher Education staff data collection includes information on the numbers and full-time equivalence (FTE) of staff employed by Table A providers (public...
higher education statisticsstaff dataselecteddepartment
https://www.bildungsserver.de/bisy.html?a=6491&spr=1
This site offers some statistical details on education in Laos (state of affairs: Population Census 2005): population by school attendance; school enrolment;...
national statisticslao pdreducationliteracy
https://www.nationalacademies.org/read/26392/chapter/4
Read chapter 1 Introduction: The education landscape in the United States has been changing rapidly in recent decades: student populations have become mor...
education statisticsreadvisionroadmapnap
https://www.abs.gov.au/statistics/classifications/australian-and-new-zealand-standard-industrial-classification-anzsic/2006-revision-2-0/detailed-classification/p/82/821/8212
This class consists of units mainly engaged in providing non-vocational instruction in the arts, including art, dance, drama and music.
arts educationclassaustralianbureaustatistics
https://www.abs.gov.au/statistics/people/aboriginal-and-torres-strait-islander-peoples/education-statistics-aboriginal-and-torres-strait-islander-peoples/2021
Early childhood, primary, secondary and non-school education statistics including highest level of education and attendance information
torres strait islandereducation statisticsaboriginalpeoples
https://www.birmingham.ac.uk/university/colleges/eps/stem/national-he-stem-programme/outputs-from-mathematics-statistics-support-higher-education-strand
The National HE STEM Programme had a strand of activity focusing upon mathematics and statistics support which was led by sigma. A comprehensive report of the...
higher educationoutputsmathematicsstatisticssupport
https://www.bildungsserver.de/bisy.html?a=8770&spr=1
The official Central Agency for Statistics (Centraal Bureau voor de Statistiek) in the Netherlands provides some news ony educational statistics as well as...
statistics netherlandscentraal bureaueducationvoorde
https://stockanalysis.com/quote/nse/GTECJAINX/statistics/
Detailed statistics for G-Tec Jainx Education Limited (NSE:GTECJAINX) stock, including valuation metrics, financial numbers, share information and more.
valuation metricsgteceducationnse
https://www.i-use.eu/
Readymade tables and introductions to statistical databases // updated statistics in education // tools for working with data // knowledge about the use and...
study toolsstatisticseducationusestatistical
https://www.gov.ie/en/department-of-education/collections/international-education-statistics/
Information on how Irish education rates compare internationally
international educationstatistics
https://www.education.gov.au/collections/selected-higher-education-statistics-students-2008
The Department of Education works to ensure Australians can experience the wellbeing and economic benefits that quality education provides.
higher education statisticsselectedstudentsdepartment
https://www.bildungsserver.de/bisy.html?a=7862&spr=1
The Education statistics for Egypt are given by UNICEF, Division of Policy and Practice, Statistics and Monitoring Section, www.childinfo.org, in May 2008....
education statisticsegypt englishinformation
https://educationdata.org/public-education-spending-statistics?ref=bluegrassinstitute.org
Find out how much the U.S. spends on public education and how the costs break down per student, by state and by level of government.
public educationspendingstatisticsperpupil
https://indianexpress.com/article/education/nit-warangal-placements-2025-vs-2024-salary-package-branch-wise-statistics-top-companies-domain-jee-main-2026-advanced-10494699/
Analysing NIT Warangal's placement data between 2023 to 2025 shows that core branches such as Mechanical, Civil and Chemical Engineering also maintained...
nit warangalplacementsvssalarypackage