https://www.prweek.co.uk/article/1942881/royal-academy-engineering-hires-pr-50th-anniversary-campaign
The Royal Academy of Engineering has hired a comms consultancy to support the charity’s 50th anniversary campaign. | PR Week UK
royalacademyengineeringhirespr
https://civilengineeringacademy.com/podcast/
Feb 25, 2021 - Ready to learn all you can about preparing for the civil FE, PE, and receive great career advice? Then listen up and we'll help you on your journey!
civil engineering academypodcast
https://academy.sphengineering.com/
The mission of SPH Engineering Academy is to provide training programs in drone technology, focusing on integrating diverse airborne sensors (GPR, Echo...
engineering academysph
https://news.mit.edu/2026/mit-community-members-elected-national-academy-engineering-0217
Seven MIT faculty members, along with 12 additional alumni, were elected to the National Academy of Engineering (NAE) for significant contributions to...
mit communitynational academymemberselectedengineering
https://engineering.princeton.edu/graduate-studies/academic-pathways/prospective-faculty
Feb 13, 2025 - The School of Engineering and Applied Science invites advanced graduate students, early-stage postdoctoral fellows, and recent Ph.D. recipients to participate...
princetonpathwaysacademyprogramengineering
https://www.udel.edu/udaily/2026/february/abraham-lenhoff-elected-national-academy-of-engineering/
UD chemical engineer honored for advancing protein purification technologies
national academyelectedengineeringudaily
https://en.acatech.de/academy/
Sep 17, 2025 - 2 acatech ist die von Bund und Ländern geförderte nationale Akademie und Stimme der Technikwissenschaften im In- und Ausland.
academynationalscienceengineering
https://news.fsu.edu/news/university-news/2025/11/17/fsu-president-mccullough-distinguished-researchers-inducted-into-academy-of-science-engineering-and-medicine-of-florida/
Nov 17, 2025 - Florida State University President Richard McCullough was among an outstanding class of inductees and new members of the Academy of Science, Engineering
fsupresidentmcculloughdistinguishedresearchers
https://www.iea.org/news/in-rare-honour-executive-director-elected-as-foreign-academician-of-chinese-academy-of-engineering
In rare honour, Executive Director elected as Foreign Academician of Chinese Academy of Engineering - News from the International Energy Agency
executive directorrarehonourelectedforeign
https://www.manchester.ac.uk/about/news/manchester-academics-elected-as-royal-academy-of-engineering-fellows/
Two University of Manchester researchers are among the 74 leading figures elected by the Royal Academy of Engineering to its Fellowship this year.Professor...
manchesteracademicselectedroyalacademy
https://www.nae.edu/323085/TsuJae-Liu-Nominated-to-be-Next-National-Academy-of-Engineering-President
NAE members will vote in March 2025 to elect a new NAE president.
naewebsitetsujaeliu
https://www.colorado.edu/chbe/kristi-anseth-awarded-national-academy-engineerings-founders-award
Distinguished Professor Kristi Anseth, also the associate faculty director of CU Boulder’s BioFrontiers Institute, designs biomaterials that interact...
national academykristiawardedengineeringfounders
https://civilengineeringacademy.com/resources-page/geotechnical-engineering-books/
Feb 8, 2021 - Here are your top resources for the geotechnical portion of the PE exam. These will help with the breadth and depth section of the PE exam!
civil engineering academybooks
https://raeng.org.uk/
We are a charity that harnesses the power of engineering to build a sustainable society and an inclusive economy that works for everyone.
royalacademyengineering
https://raeng.org.uk/about-us/fellowship/new-fellows-2025/
Meet our 2025 cohort of Fellows, International Fellows and Honorary Fellows.
royalacademyengineeringfellows
https://jellyfish.co/learn/engineering-leadership-academy/
Dec 20, 2024 - Take your engineering leadership skills to the next level through a catalog of content taught by world-class engineering leaders.
engineering leadershipacademyjellyfish
https://raeng.org.uk/news/
Read the latest news releases from the Academy relating to our engineering projects and initiatives, our latest reports and topical events in engineering.
royalacademyengineeringnews
https://civilengineeringacademy.com/resources-page/construction-books/
Apr 21, 2021 - Here are your resources for studying for the construction portion of the PE exam. These will help with your depth section.
civil engineering academyconstructionbooks
https://civilengineeringacademy.com/resources-page/
Mar 7, 2023 - Civil Engineering Academy has listed the most common books that you will need to ace the civil engineering breadth and depth PE exam. Check them out here.
civil engineering academyresources
https://www.umu.se/en/news/computer-scientist-new-representative-in-the-royal-swedish-academy-of-engineering-sciences_11993299/
Oliver Larsson new representative in the Royal Swedish Academy of Engineering Sciences' Student Council.
computerscientistnewrepresentativeroyal
https://civilengineeringacademy.com/ca-civil-seismic-course/
Nov 8, 2021 - Civil Engineering Academy and PPI have partnered up to offer you a killer CA Civil Seismic Course for your California Seismic Exam.
engineering academycivilseismiccourse
https://civilengineeringacademy.com/resources-page/transportation-engineering-books/
Feb 8, 2021 - Here are your top resources for the transportation portion of the PE exam. They will help on the breadth and depth portion of the PE!
civil engineering academytransportationbooks
https://www.autosport.com/autosport-awards/news/komatsu-williams-engineering-academy-students-to-be-unveiled-at-autosport-awards/10691751/
Jan 27, 2025 - The 10 successful applicants to the STEM-led initiative will be presented at the Roundhouse as part of the 2025 ceremony
engineering academykomatsuwilliamsstudentsunveiled
https://civilengineeringacademy.com/resources-page/water-resources-engineering-books/
Feb 8, 2021 - Here are your top resources for the water resources portion of the PE exam! Closed conduit, open channel, hydrology - it's all here for you!
civil engineering academywater resourcesbooks
https://www.nae.edu/345149/NAENewClass2026?layoutChange=LowGraphics
The National Academy of Engineering (NAE) today announced the election of 130 members and 28 international members to its Class of 2026, said NAE President Tsu
national academynaewebsiteengineeringmembers
https://civilengineeringacademy.com/resources-page/fe-resources/
Mar 7, 2023 - Check out the best free and not-so-free resources for the FE (Fundamentals of Engineering) Exam. We even have free lectures and more! Check it out!
civil engineering academyferesources
https://www.hku.hk/press/news_detail_28774.html
Professor Max Shen elected as International Member of the Chinese Academy of Engineering. Professor Max Shen, Vice-President and Pro-Vice-Chancellor (Research)...
international memberprofessormaxshenelected
https://civilengineeringacademy.com/floodplain-manager-exam/
May 10, 2024 - Check out our practice exam to help you prepare for (and pass) the Certified Floodplain Manager (CFM®) Exam.
civil engineering academypractice exammanager
https://www.nae.edu/345149/NAENewClass2026
The National Academy of Engineering (NAE) today announced the election of 130 members and 28 international members to its Class of 2026, said NAE President Tsu
national academynaewebsiteengineeringmembers
https://www.idirect.net/technology/the-academy/
Sep 29, 2025 - The Academy offers open training to design, operate and manage satellite networks using our iDirect product lines.
openacademytrainingstengineering
https://civilengineeringacademy.com/resources-page/structural-engineering-books/
Oct 18, 2021 - Here are your top resources for studying for the structural portion of the PE exam. These will help with the breadth and depth portion of the PE exam!
civil engineering academystructuralbooks
https://www.electronicspecifier.com/news/appointments/royal-academy-of-engineering-announces-new-ceo/
Nov 28, 2025 - The Royal Academy of Engineering has appointed Dame Tamara Finkelstein DCB as its next CEO to lead the charity.
electronic specifierroyalacademyengineeringannounces
https://raeng.org.uk/programmes-and-prizes/programmes/uk-grants-and-prizes/support-for-research/chair-in-emerging-technologies/
This scheme provides long-term support to research visionaries developing emerging technology areas that have potential to deliver economic and social benefit
emerging technologiesroyalacademyengineeringchair
https://www.eng.mcmaster.ca/news/mcmaster-professor-marilyn-lightstone-elected-as-a-fellow-into-the-canadian-academy-of-engineering/
May 22, 2024 - Long-time Mechanical Engineering professor Marilyn Lightstone and the first woman Department Chair in the history of the Faculty of Engineering at McMaster...
mcmasterprofessormarilynelectedfellow
https://civilengineeringacademy.com/cea-partners/
Dec 3, 2022 - Civil Engineering Academy has teamed up with some awesome partners. Check out all of our partners including past podcast guests with great products and...
civil engineering academyceapartners
https://interestingengineering.com/ie-academy
Jul 24, 2024 - Earn certifications that matter with IE Academy. Each course completion awards you a certificate, showcasing your expertise and dedication to continuous...
certification coursesieacademyonlineengineering
https://fire-safety.academy/courses/introduction-to-fire-safety-engineering/
This website is still under construction. We aim at launching our first courses in Amsterdam in 2026. Emiel van Rossum Introduction This 5-day course provides...
fire safety engineeringintroductionacademy
https://www.octo.academy/catalogue/domaine/data-engineering/
Pour vos projets de Big Data, les spécialistes OCTO Academy du Data Engineering mettent leur expertise au service de vos équipes dans des modules dédiés.
data engineeringformationsoctoacademy
https://civilengineeringacademy.com/errata/
Jul 23, 2025 - You'll find all of the necessary errata that accompanies all of the civil PE exams that we have made right here. Make sure yours is up to date!
civil engineering academyerrata
https://www.octo.academy/catalogue/domaine/software-engineering/
Parce que la qualité du logiciel passe par la communication et la transmission, appropriez-vous les meilleures pratiques du Software Engineering avec OCTO.
software engineeringformationsoctoacademy
https://clarivate.com/news/clarivate-the-chinese-academy-of-engineering-and-the-higher-education-press-of-china-release-annual-report-to-reveal-future-innovation-in-engineering-science-and-technology/
Tracking development trend by identifying 187 research areas
higher educationclarivatechineseacademyengineering
https://www.purdue.edu/newsroom/2026/Q1/purdue-president-3-alumni-elected-to-national-academy-of-engineering/
Feb 11, 2026 - Purdue University President Mung Chiang has been elected as a member of the National Academy of Engineering.
national academypurduepresidentalumnielected
https://civilengineeringacademy.com/join-our-newsletter/
May 7, 2022 - Ready to join our free newsletter and learn all the tips, tools, and tactics to ace the civil FE, PE, and your career? Join up today!
civil engineering academyjoinnewsletter
https://www.e4company.com/case-studies-hpc/its-umbria-smart-academy/
Aug 31, 2022 - ITS Umbria aveva necessità di implementare un’infrastruttura, "chiavi in mano", ad alte prestazioni che potesse ospitare piattaforme di analisi...
case studycomputer engineeringumbriasmartacademy
https://www.nae.edu/338483/TsuJae-Liu-Named-President-of-National-Academy-of-Engineering-
The National Academy of Engineering (NAE) is pleased to announce the appointment of Tsu-Jae Liu as its next president. A trailblazing researcher, innovator, edu
national academynaewebsitetsujae