Sponsor of the Day:
Jerkmate
https://www.pinterest.com/VNutritionist/
VNutrition | Healthy Vegan Recipes (VNutritionist) - Profile | Pinterest
VNutrition | Healthy Vegan Recipes | Find healthy vegan recipes for plant-based diets.
healthy vegan recipesprofile pinterest
https://www.veganrecipeclub.org.uk/recipes/healthy-recipes-vegan/
97+ Healthy Vegan Recipes - Vegan Recipe Club
Mar 7, 2023 - Hundreds of tried and tested vegan recipes, with product tips and news! We’ve got convenience-style supermarket meals and beginner recipes, right up to...
healthy vegan recipes97club
https://veggiekinsblog.com/
Veggiekins by Remy Park | Healthy Vegan Recipes & Wellness
Jun 23, 2023 - Welcome to Veggiekins Blog, home to nourishing vegan + gluten-free recipes and tips to live your best balanced and holistic life. I’m a human on a mission to...
healthy vegan recipesveggiekinsremyparkwellness
https://choosingchia.com/category/diet/vegan/
Easy and Healthy Vegan Recipes - Choosing Chia
Looking for easy and healthy vegan recipes? From vibrant breakfasts to hearty mains and sweet plant-based treats, these recipes are full of flavor and perfect...
healthy vegan recipeschoosing chiaeasy
https://vancouverwithlove.com/
Vancouver with Love | Healthy vegan recipes and lifestyle.
Jan 24, 2024 - Welcome to Vancouver with Love. Sharing delicious vegan recipes that are gluten-free and refined sugar-free, as well as plant-based guides and travel.
healthy vegan recipesvancouverlovelifestyle
https://www.diannesvegankitchen.com/
Healthy Vegan Recipes – Dianne's Vegan Kitchen
Apr 1, 2026 - Dianne's Vegan Kitchen is home to all things vegan! Here you'll find healthy vegan recipes and healthy plant-based living tips.
healthy vegan recipesdiannekitchen
https://happyfoodhealthylife.com/
Delicious Healthy Vegan Recipes for the Whole Family - Happy Food, Healthy Life
Aug 14, 2025 - Breakfast Dinners Desserts Sides Nourish to flourish—happy foods make for a happy life. Breakfast Main Dish Side Dishes Dessert Drinks Snacks + Apps All the...
healthy vegan recipeswhole familyfood lifedelicioushappy
https://exsloth.com/
Easy Vegan Recipes and Healthy Living Tips - Diary of an ExSloth
Nov 4, 2016 - Canada based blogger sharing easy vegan recipes, perfect for lazy girls everywhere, plus simple tips for healthy eating and creating a healthy lifestyle.
easy vegan recipeshealthy living tipsdiary
https://thegreenloot.com/vegan-green-smoothie-recipes/
20+ Healthy Vegan Green Smoothie Recipes | The Green Loot
Mar 8, 2025 - Boost your energy and nutrition intake with these super healthy vegan green smoothie recipes. Made with spinach, protein powder and more filling ingredients.
20 healthyvegan greensmoothie recipesloot
https://biancazapatka.com/en/about-me/
Hi, I am Bianca! - Bianca Zapatka | healthy vegan & vegetarian recipes!
Dec 30, 2022 - Hey there! Welcome to my blog! I’m Bianca - the writer, photographer, food stylist and recipe developer behind this food blog. You can learn more about me here.
bianca zapatka healthyvegan vegetarian recipeshi
https://biancazapatka.com/en/recipe-index/
Recipe-Index - Bianca Zapatka | healthy vegan & vegetarian recipes!
Nov 20, 2020 - You're looking for healthy vegan recipes, which are quick and easy to make? Then you are at the right place! With over 250 recipes you will surely find...
bianca zapatka healthyvegan vegetarian recipesindex
https://www.skinnytaste.com/recipes/vegan/
Easy Vegan Recipes | Healthy Plant Based and Vegan Meals
These healthy vegan recipes and plant-based meals are nutritious, delicious, and guaranteed to satisfy, from vegan breakfast ideas to meatless dinners.
easy vegan recipeshealthy plant basedmeals
https://vegangela.com/
Vegan Recipes — Quick, Easy & Healthy! | Vegangela
quick easy healthyvegan recipesvegangela
https://www.thehealthy.com/food/recipes/vegan-recipes-meal-ideas/
12 Delicious Vegan Recipes for Breakfast, Lunch, and Dinner | The Healthy
Jan 11, 2023 - Food experts share their delicious vegan recipes for breakfast, lunch, and dinner to show you how easy—and delicious—a vegan diet can be.
delicious vegan recipesbreakfast lunch12dinnerhealthy
https://elavegan.com/
Elavegan - Simple, healthy, and delicious vegan recipes
Vegan recipes from Michaela Vais, author of the Simple and Delicious Vegan Cookbook. Includes gluten-free, healthy, and plant-based recipes.
delicious vegan recipessimple healthyelavegan
https://www.simplyquinoa.com/category/recipes/dessert/
Dessert Recipes | Healthy, Easy Gluten-Free and Vegan Desserts
Indulge (guilt-free!) in our best healthy dessert recipes! These easy desserts are 100% gluten-free and dairy-free, with vegan recipes, too.
recipes healthy easygluten freevegan desserts
https://www.realfoodforlife.com/vegan-recipes/breakfast/
Vegan Breakfast Recipes, a Healthy Start to Your Day
vegan breakfast recipeshealthy startday
https://www.onegreenplanet.org/vegan-food/healthy-vegan-omega-3-rich-recipes/
10 Healthy Vegan Omega 3-Rich Recipes – One Green Planet
Sep 26, 2017 - Lucky for us, plant-based foods are packed with omega-3 fats, so eat up as many of them as you can so you can get the benefits. Here are 10 recipes to get you...
one green planet10 healthyomega 3veganrich
https://www.theblendergirl.com/
The Blender Girl - Easy Healthy Recipes {Vegan + Gluten-Free}
May 14, 2020 - The Blender Girl shares easy healthy recipes that are all vegan and gluten-free, and use whole natural ingredients. Use your blender to make amazing dishes.
easy healthy recipesvegan gluten freeblendergirl
https://runningonrealfood.com/category/recipes/vegan-soup-recipes/
Vegan Soup Recipes (Easy, Healthy & Meal-Prep Friendly)
Healthy vegan soup recipes made with simple ingredients. Easy, cozy plant-based soups perfect for weeknight dinners, meal prep, and freezing.
recipes easy healthymeal prep friendlyvegansoup
https://www.myplantifulcooking.com/healthy-sweet-treats/
Healthy Vegan Dessert Recipes – My Plantiful Cooking
Satisfy your sweet tooth with our indulgent yet light and healthy vegan dessert recipes made from wholesome ingredients.
vegan dessert recipesplantiful cookinghealthy
https://www.vegparadise.com/
VegParadise | Vegan Recipes, Reviews & Healthy Swaps
Apr 7, 2026 - Explore vegan recipes, food reviews, and healthy meat-free swaps. VegParadise is your go-to blog for low-carb, low-fat plant-based inspiration.
vegan recipesreviews healthyvegparadiseswaps
https://biancazapatka.com/en/my-cookbooks/
My Cookbooks - Vegan Cooking and Baking Recipes - Bianca Zapatka | healthy vegan & vegetarian...
recipes bianca zapatkavegan cookinghealthy vegetariancookbooksbaking
https://www.veganfamilyrecipes.com/healthy-potato-pea-soup/
Healthy Potato Pea Soup - Vegan Family Recipes
pea soup veganhealthy potatofamily recipes
https://simple-veganista.com/recipes/course/dinner/easy-weeknight-dinner-recipes/
Easy Vegan Weeknight Dinners: Quick, Healthy Recipes in 30 Minutes or Less
Easy vegan weeknight dinners ready in 30 minutes or less! Quick, healthy, plant-based recipes like one-pan meals, hearty bowls, and simple pastas for busy...
quick healthy recipeseasy veganweeknight dinners30 minutesless
https://healthylittlevittles.com/
Healthy Little Vittles | Gluten-free, Vegan & Plant-based Recipes
Mar 5, 2026 - Healthy Little Vittles is your go-to destination for delicious gluten-free, vegan, and plant-based recipes designed to nourish and inspire. From no-bake...
gluten free veganplant based recipeshealthy littlevittles
https://dietitiandebbie.com/
Healthy Vegan & Vegetarian Recipes | Dietitian Debbie Dishes
Feb 19, 2025 - Dietitian Debbie Dishes is a healthy living blog where you'll find tasty vegetarian recipes and helpful nutrition tips.
healthy vegan vegetariandietitian debbie dishesrecipes