Robuta

https://www.happycow.net/recipes/pomegranate-and-maple-glazed-beets
How to make Pomegranate and Maple-Glazed Beets A vegan / vegetarian Pomegranate and Maple-Glazed Beets recipe.
healthy vegan recipespomegranatemapleglazedbeets
https://www.vegkit.com/recipes/vegan-snacks/
From wholesome energy balls and crunchy roasted nuts to savoury scrolls and homemade dips — these vegan snacks will keep you fueled between meals.
vegan snackseasy recipestastyhealthyamp
https://www.happycow.net/recipes/easy-coconut-cake
How to make Easy Coconut Cake A vegan / vegetarian Easy Coconut Cake recipe.
healthy vegan recipescoconut cakeeasyhappycow
https://vegangela.com/
Dec 19, 2021 - Healthy vegan recipes, including many quick and easy recipes for weekday lunches & dinners. Many gluten-free & low-carb options.
vegan recipesquickeasyhealthyvegangela
https://www.christinacooks.com/
Oct 22, 2025 - Explore healthy, delicious vegan recipes and cooking tips with Christina Cooks. Transform your life with plant-based living.
vegan recipescooking tipschristinacookshealthy
https://www.happycow.net/recipes/low-calorie-minestrone
How to make Low Calorie Minestrone A vegan / vegetarian Low Calorie Minestrone recipe.
healthy vegan recipeslow calorieminestronehappycow
https://thehealthyfamilyandhome.com/
Aug 23, 2025 - Over 500+ easy and healthy plant-based recipes that are both gluten-free + vegan and made with clean, real food ingredients!
gluten freevegan recipeshealthyfamily
https://www.vegkit.com/recipes/vegan-healthy-choice/
Explore balanced vegan recipes—from protein-packed salads to nutrient-dense bowls—and discover how simple it is to embrace a healthier lifestyle at VegKit!
healthy choicevegan recipesnutritious mealswholesomeamp
https://simple-veganista.com/
Feb 27, 2026 - Simple vegan recipes for every day — easy, healthy, wholesome plant-based meals, dinners, desserts, breakfasts & snacks. Oil-free options, meal prep ideas &...
vegan recipesplant basedsimpleeasyhealthy
https://nosweatvegan.com/
Mar 5, 2026 - Whether you're new to plant-based eating or you've been vegan for a decade, you'll find all the delicious and healthy recipes you need at No Sweat Vegan
plant based recipessimplehealthysweatvegan
https://kiipfit.com/
Browse hundreds of healthy vegan, paleo, and gluten-free recipes to maximize your diet and lifestyle! From glazed chocolate oatmeal cookies to orange almond...
gluten free recipeshealthy veganwholesomepaleocom
https://www.diannesvegankitchen.com/
Mar 4, 2026 - Dianne's Vegan Kitchen is home to all things vegan! Here you'll find healthy vegan recipes and healthy plant-based living tips.
healthy vegan recipesdiannekitchen
https://www.happycow.net/recipes/cuisine/casseroles
Healthy and nutritious vegan and vegetarian Casseroles recipes by HappyCow.
healthy vegan recipescasseroleshappycow
https://kiipfit.com
Browse hundreds of healthy vegan, paleo, and gluten-free recipes to maximize your diet and lifestyle! From glazed chocolate oatmeal cookies to orange almond...
gluten free recipeshealthy veganwholesomepaleocom
https://www.loveandlemons.com/?ref=starikov.co
Recipes and tips from Jeanine Donofrio, writer of The Love and Lemons Cookbook. Includes vegetarian recipes, gluten free recipes, and vegan recipes.
whole foodvegetarian recipeslovelemonshealthy
https://www.bbcgoodfood.com/recipes/collection/healthy-vegan-dinner-recipes
Be inspired by our healthy plant-based dinner ideas, including nutritious stews and soups plus curries, chillis, risottos, pasta dishes and more.
vegan dinner recipesgood foodhealthy
https://happyfoodhealthylife.com/
Aug 14, 2025 - Breakfast Dinners Desserts Sides Nourish to flourish—happy foods make for a happy life. Breakfast Main Dish Side Dishes Dessert Drinks Snacks + Apps All the...
healthy vegan recipeswhole familydelicioushappyfood
https://getsocialpr.com/story20049793/the-fact-about-vegan-healthy-recipes-dinner-that-no-one-is-suggesting
healthy recipesfactvegandinnerone
https://www.happycow.net/recipes/seitan-lasagna
How to make Seitan Lasagna A vegan / vegetarian Seitan Lasagna recipe.
healthy vegan recipesseitanlasagnahappycow
https://biancazapatka.com/en/
Healthy vegan recipes, which are quick and easy to make. Foodblog with tasty foodporn, food photography and styling.
bianca zapatkahealthy veganvegetarian recipesfoodblog
https://www.blissfulbasil.com/
May 22, 2023 - Plant-based vegan recipes to nourish the mind, body, and soul! Wholesome foods lay the foundation for a vibrant, energized life.
plant basedvegan recipeshealthyblissfulbasil
https://www.happycow.net/recipes/cuisine/holiday-dishes
Healthy and nutritious vegan and vegetarian Holiday Dishes recipes by HappyCow.
healthy vegan recipesholiday disheshappycow
https://www.happycow.net/recipes/mock-chicken-tofu
How to make Mock Chicken Tofu A vegan / vegetarian Mock Chicken Tofu recipe.
healthy vegan recipesmock chickentofuhappycow
https://www.happycow.net/recipes/gurkha-curry
How to make Gurkha Curry A vegan / vegetarian Gurkha Curry recipe.
healthy vegan recipesgurkhacurryhappycow
https://vancouverwithlove.com/
Jan 24, 2024 - Welcome to Vancouver with Love. Sharing delicious vegan recipes that are gluten-free and refined sugar-free, as well as plant-based guides and travel.
healthy vegan recipesvancouverlovelifestyle
https://www.vegparadise.com/
Feb 7, 2026 - Explore vegan recipes, food reviews, and healthy meat-free swaps. VegParadise is your go-to blog for low-carb, low-fat plant-based inspiration.
vegan recipeshealthy swapsreviews
https://veganuary.com/en-us/recipes/superfood-salad/
Our superfood salad is an easy to make, super healthy treat! Full of quinoa, sweet potato, kale, pecans, sunflower seeds and pumpkin seeds!
healthy vegan recipessuperfoodsaladveganuaryusa
https://www.happycow.net/recipes/coco-nutty-cuties
How to make Coco-Nutty Cuties A vegan / vegetarian Coco-Nutty Cuties recipe.
healthy vegan recipescoconuttycutieshappycow