Robuta

https://www.sportsnet.ca/nhl/article/canadiens-jeff-petry-out-indefinitely-with-lower-body-injury/ Canadiens' Jeff Petry out indefinitely with lower-body injury - Sportsnet.ca Mar 26, 2022 - Montreal Canadiens defenceman Jeff Petry will be out indefinitely with a lower-body injury. jeff petrylower bodycanadiensindefinitely https://www.gamingaustralia.com.au/post/dying-light-2-delayed-indefinitely Dying light 2 delayed indefinitely. Jan 20, 2020 - As seems to be the trend at the moment yet another developer has announced a delay to the release of their upcoming game. This time it's Dying Light 2 that... dying lightdelayedindefinitely https://abcnews.com.pk/rawalpindi-police-deny-reports-of-markets-being-closed-indefinitely/ Rawalpindi police deny reports of markets being closed indefinitely Apr 19, 2026 - Rawalpindi police on Saturday denied reports regarding the closure of markets across the city until further notice, terming them baseless. rawalpindipolicedenyreportsmarkets https://educationboard.co.ke/litein-boys-closed-indefinitely-following-students-unrest-over-this-issue/ Litein Boys Closed Indefinitely Following Students Unrest Over This Issue | Education Board Sep 22, 2025 - Litein Boys High School in Bureti Constituency , Kericho County , has now been closed indefinitely. This is following a violent night of student unrest that... https://www.wyso.org/npr-news/2025-11-15/judge-indefinitely-bars-trump-from-fining-uc-over-alleged-discrimination Judge indefinitely bars Trump from fining UC over alleged discrimination | WYSO Nov 15, 2025 - The Trump administration demanded UCLA pay $1.2 billion to restore frozen research funding and ensure eligibility for future funding after accusing the school... judgeindefinitelybarstrump https://magazine.dagga.za.net/2021/09/25/anderson-county-upstate-fall-festival-corn-maze-now-underway-wyff/ DOMAIN INDEFINITELY SUSPENDED domainindefinitelysuspended https://mkecitywire.com/who-were-the-indefinitely-confined-voters-in-milwaukee-ward-164/ Who were the indefinitely confined voters in Milwaukee, Ward 164? - Milwaukee City Wire Oct 30, 2025 - 64 indefinitely confined voters in Milwaukee, Ward 164 automatically received absentee ballots, according to the Wisconsin Elections Commission. https://newscord.org/article/tehran-stages-military-parades-as-trump-indefinitely-extends-us-iran-ceasefire--Story_20260422_IranDigitalBlackoutP1f05b11d Tehran Stages Military Parades as Trump Indefinitely Extends US-Iran Ceasefire: 9 Sources (West... Apr 22, 2026 - 9 sources compared: West Asian (4), Western Mainstream (2), Western Alternative (2). Tehran staged large military parades on Tuesday as a US-Iran ceasefire... https://www.theoasisreporters.com/possible-cia-report-us-embassy-abuja-stops-visa-consular-services-indefinitely/ Possible CIA Report: US Embassy, Abuja Stops Visa, Consular Services Indefinitely | The Oasis... Aug 14, 2018 - The Oasis Reporters August 14, 2018 In a move that left many baffled, the United States Embassy Tuesday said it has shut its visa and consular services section... https://magazine.dagga.za.net/2014/11/12/rolling-paper-review-rolling-away-the-victor/la-transparent/ DOMAIN INDEFINITELY SUSPENDED domainindefinitelysuspended https://www.whats-on-netflix.com/news/mindhunter-season-3-netflix-what-we-know-so-far-01-20/ Mindhunter Season 3: Series on Hold Indefinitely Oct 19, 2024 - We're done with the waiting so hopefully, Netflix isn't going to make us wait another 22 months for another round of Mindhunter! After another excellent on holdmindhunterseasonseriesindefinitely https://chamberlainsun.com/your-go-to-bay-area-starbucks-location-may-be-closed-indefinitely/ Your Go-to Bay Area Starbucks location may be closed indefinitely - Chamberlainsun Local News Aug 11, 2024 - February 13, 2022Updated: February 13, 2022 10:57 AM Dozens of Starbucks locations are currently closed across the Bay Area as the ubiquitous coffee chain... https://itbusinessdirect.com/tag/indefinitely/ Indefinitely - itbusinessdirect indefinitely https://thedefensewatch.com/naval-maritime/iran-seizes-ships-in-strait-of-hormuz-after-trump-halts-attacks-indefinitely/ Iran Seizes Ships In Strait Of Hormuz After Trump Halts Attacks Indefinitely | TheDefenseWatch.com Apr 22, 2026 - Iran seizes ships in Strait of Hormuz after Trump halts attacks, raising fresh concerns over Gulf maritime security and global oil routes. https://www.fromrome.info/2025/02/16/breaking-pope-francis-to-remain-in-hospital-indefinitely-as-of-feb-16-2025/ BREAKING: Pope Francis to remain in Hospital indefinitely, as of Feb. 16, 2025 | From Rome Feb 17, 2025 - Editor's Note: The report, which you can click above, from Reuters, contains more alarming news: the spokesman will no longer say when Pope Francis will be... https://mkecitywire.com/who-were-the-indefinitely-confined-voters-in-village-of-brown-deer-ward-5/ Who were the indefinitely confined voters in Village of Brown Deer, Ward 5? - Milwaukee City Wire Oct 30, 2025 - 89 indefinitely confined voters in the Village of Brown Deer, Ward 5 automatically received absentee ballots, according to the Wisconsin Elections Commission. https://blog.trvth.org/2024/09/indefinitely-perfectible.html TRVTH: Indefinitely Perfectible The methods of science aren't foolproof, but they are indefinitely perfectible. Just as important: there is a tradition of criticism that e... trvthindefinitelyperfectible https://definition.org/define/indefinitely/ Definition of indefinitely - Definition.org Definitions of indefinitely. What is indefinitely: For a long time, no end defined. Synonyms: definitely, vaguely definition ofindefinitely https://forum.espocrm.com/forum/general/126279-authmaxusernamefailedattemptnumber-block-indefinitely authMaxUsernameFailedAttemptNumber block indefinitely? - EspoCRM Open Source Community Forum open source communityblockindefinitelyespocrmforum https://dagga.za.net/2019/04/26/420m-raise-sets-us-cannabis-record-bofa-begins-mj-coverage-medmen-exec-turnover-more-of/ DOMAIN INDEFINITELY SUSPENDED domainindefinitelysuspended https://mkecitywire.com/who-were-the-indefinitely-confined-voters-in-milwaukee-ward-275/ Who were the indefinitely confined voters in Milwaukee, Ward 275? - Milwaukee City Wire Oct 30, 2025 - 155 indefinitely confined voters in Milwaukee, Ward 275 automatically received absentee ballots, according to the Wisconsin Elections Commission. https://cubarights.blogspot.com/2013/11/cuba-indefinitely-suspends-consular.html Cuba Human Rights: Cuba indefinitely suspends consular services in U.S. Posted on Tuesday, 11.26.13 Cuba indefinitely suspends consular services in U.S. BY ALFONSO CHARDY ACHARDY@ELNUEVOHERALD.COM In a s... cuba human rightsconsular servicesindefinitelysuspends https://wp-admin.uscho.com/2011/11/04/michigan-state-freshman-carney-suffers-neck-injury-out-indefinitely/ Michigan State freshman Carney suffers neck injury, out indefinitely - College Hockey | USCHO.com Nov 4, 2011 - Michigan State freshman defenseman Branden Carney sustained a serious neck injury in practice on Thursday afternoon, but has feeling, movement and https://www.rferl.org/a/russia-suspends-nord-streams-energy-ukraine/32016816.html Russia Suspends Nord Stream 1 Deliveries Indefinitely, Raising Fears Of Energy Crunch Russia is suspending the flow of gas supplies through the crucial Nord Stream 1 pipeline indefinitely, raising fears of an energy shortage in Europe as the... nord stream https://www.aproko247.com/tag/indefinitely/ indefinitely - Aproko247 Magazine indefinitelymagazine https://www.nationalheraldindia.com/international/donald-trumps-classified-documents-trial-postponed-indefinitely Donald Trump's classified documents trial postponed indefinitely May 8, 2024 - Judge Aileen Cannon cited unresolved legal issues for the postponement; trial unlikely to begin before the US presidential election in November donald trumpclassified documentstrialpostponedindefinitely https://beatabookie.com/gordon-hayward-out-indefinitely/ Gordon Hayward Out Indefinitely - How To Beat A Bookie Nov 28, 2022 - Charlotte Hornets veteran forward Gordon Hayward will be out indefinitely due to a left shoulder fracture, per Shams Charania of The Athletic. Earlier in the... gordon haywardhow toindefinitelybeatbookie https://www.cbsnews.com/texas/news/passport-offices-collin-county-closed-indefinitely/ Passport Offices In Collin County Closed Indefinitely - CBS Texas Collin County's District Clerk strongly criticized the Dallas Passport Agency and Bureau of Consular Affairs over a two-month-long passport office shutdown,... passport officescollin countyclosedindefinitelycbs https://gatlabs.com/faqs/how-long-is-the-gat-admin-log-retained-for-indefinitely/ How long is the GAT+ admin log retained for? Indefinitely? - GAT for Enterprise how longis theadmin loggat https://ovio.co.za/abc-pulls-jimmy-kimmel-live-indefinitely-after-monologue-on-charlie-kirk-killing-claims ABC pulls Jimmy Kimmel Live indefinitely after monologue on Charlie Kirk killing claims ABC has pulled Jimmy Kimmel Live after a September 15 monologue about the reported killing of Charlie Kirk sparked backlash, affiliate preemptions, and talk of... jimmy kimmel live https://magazine.dagga.za.net/2022/05/18/traverse-city-outlines-restrictions-timeline-for-recreational-marijuana-9-10-news/ DOMAIN INDEFINITELY SUSPENDED domainindefinitelysuspended https://theday.co.uk/glossary/indefinitely/ Indefinitely - The Day For an unlimited time, or a time with no clear end. indefinitelyday https://malibucountrymart.com/events/fireball-tims-wheels-waves-fall-2020/ Fireball Tim’s Wheels & Waves – Postponed Indefinitely - Malibu Country Mart malibu countryfireballwheelswavespostponed https://magazine.dagga.za.net/2014/12/13/2014-high-times-amsterdam-cannabis-cup-legalization-spotlight/ DOMAIN INDEFINITELY SUSPENDED domainindefinitelysuspended https://www.brunchboxing.com/post/lester-martinez-bout-against-joeshon-james-postponed-indefinitely Lester Martinez Bout Against Joeshon James Postponed Indefinitely Oct 24, 2024 - By Matthew Brown10/24/2024The super middleweight clash between two undefeated rising stars, Lester Martinez and Joeshon James, has been postponed indefinitely.... lester martinezjoeshon jamesboutpostponedindefinitely https://torquecafe.com/general-motors-news-chevrolet-gmc-electric-pickups-delayed/ General Motors delaying next-gen EV pickups 'indefinitely' - report - Torquecafe.com Apr 22, 2026 - Lower than expected demand for electric pickups, combined with incentives for carmakers to produce cleaner models being axed, has already general motorsdelayingnext https://www.cwicorp.com/news/division-of-family-resources-offices-to-close-to-the-public-indefinitely-to-protect-the-health-and-safety-of-clients-and-staff/ Division of Family Resources offices to close to the public indefinitely to protect the health and... Mar 20, 2020 - FOR IMMEDIATE RELEASEMarch 20, 2020 Division of Family Resources offices to close to the public indefinitely to protect the health and safety of clients and... https://kgeetv.com/parliament-adjourned-indefinitely-amid-vacant-seats-controversy/ Parliament Adjourned Indefinitely Amid Vacant Seats Controversy - kgeetv Oct 22, 2024 - Speaker of Parliament Alban Bagbin has adjourned sitting indefinitely due to the ongoing controversy surrounding vacant seats in the House. The decision comes... parliamentadjournedindefinitelyamidvacant https://thebaltimorewire.com/2015/06/08/maryland-football-juwann-winfree-suspended-indefinitely/ Maryland Football: Juwann Winfree Suspended Indefinitely Jun 9, 2015 - Maryland football took another big hit on Monday when wide receiver Juwann Winfree was suspended indefinitely for violation of the student code of conduct. maryland footballjuwann winfreesuspendedindefinitely https://ulearnlms.com/gomal-university-closes-indefinitely-due-to-threats/ Gomal University Closes Indefinitely Due to Threats due touniversityclosesindefinitelythreats https://prepareforchange.net/2021/11/07/sweden-indefinitely-suspends-moderna-shot-after-deadly-heart-condition/ Sweden Indefinitely Suspends Moderna Shot After Deadly Heart Condition - Prepare For Change https://dagga.za.net/2019/09/20/cannabis-hiring-platform-vangst-kicks-off-social-equity-program-with-san-francisco-career-fair/ DOMAIN INDEFINITELY SUSPENDED domainindefinitelysuspended https://wrestletalk.com/news/top-wwe-star-fined-suspended-indefinitely-gunther/ WWE Star 'Suspended Indefinitely' - WrestleTalk Apr 25, 2025 - A top WWE star has been 'fined' and 'suspended indefinitely' following their actions on Monday Night Raw. wwe starsuspendedindefinitely https://givemeporn.club/clip/this-dildo-can-give-pleasure-indefinitely-412184 This dildo can give pleasure indefinitely - Porn Clip at GiveMePorn.Club Infinite short porn clips for Adults. Less than 1 minute porn! dildogivepleasure https://dagga.za.net/2019/04/30/episode-249-bidens-dismal-record-on-cannabis-2/ DOMAIN INDEFINITELY SUSPENDED domainindefinitelysuspended https://cdllife.com/2020/bee-infestation-shutters-rest-area-indefinitely/ Bee infestation shutters rest area indefinitely May 28, 2020 - Authorities in Nevada say that they were forced to shut down a rest area this week after they discovered a large bee infestation. rest areabeeinfestationshuttersindefinitely https://cdllife.com/2021/lengthy-detours-for-truckers-after-i-70-through-glenwood-canyon-closes-indefinitely/ Lengthy detours for truckers after I-70 through Glenwood Canyon closes indefinitely Aug 2, 2021 - The Colorado Department of Transportation (CDOT) says that I-70 is closed in both directions through Glenwood Canyon due to "extreme damage" caused by for truckers https://slaylebrity.com/images/the-jacquemus-teeny-weeny-bag-could-change-the-hand-bag-game-indefinitely/ The Jacquemus teeny weeny bag could change the hand bag game indefinitely - Slaylebrity Mar 28, 2019 - Tiny handbags from the French label Jacquemus became big news when they appeared on the catwalk during Paris fashion week last month. The Mini Le Chiquito is a... teeny weenyjacquemusbag https://www.littlebizzy.com/blog/wp-stagecoach-suspended WP StageCoach Service Indefinitely Suspended - LittleBizzy After much consideration, we've decided to indefinitely suspend the WP StageCoach service that we'd been providing free of charge to all of our managed hosting... wpstagecoachserviceindefinitelysuspended https://acfa.org.sg/newsletters/china-new-consumption-tax-delayed China's new consumption tax delayed indefinitely after initial uproar consumption taxchinanewdelayedindefinitely https://reportersatlarge.com/aero-contractors-suspends-operations-indefinitely-sends-staff-leave/ Aero Contractors Suspends Operations Indefinitely, Sends Staff On Leave | Reporters At Large Apr 27, 2026 - AERO Contractors Airlines on Wednesday said that it would suspend all its scheduled services indefinitely from Thursday Sept. 1. The aero contractors https://www.fortifyrights.org/mly-inv-2026-03-12/?fbclid=IwdGRjcAQfuEJjbGNrBB-4N2ZkaWQWUCx2UlF48YAUzFkLfpuQqtIl4Keiv2V4dG4DYWVtAjExAHNydGMGYXBwX2lkDD Malaysia: Rohingya Refugees Held Indefinitely in Inhumane and Degrading Conditions - Fortify Rights Mar 19, 2026 - New refugee registration scheme must end the indefinite detention of refugees rohingya refugees https://www.maastrichtuniversity.nl/nl/events/studium-generale-walking-against-expulsion-community-politics-refugee-tales Refugee Tales: Writers Tell the Tales of Immigrants Detained Indefinitely - Agenda - Maastricht... refugeetaleswriterstell https://support.servicenow.com/kb?id=kb_article_view&sysparm_article=KB0719398 Notification Preferences - Notification Loading indefinitely - Known Error - Now Support Portal 1. Login into a London Patch 1 Hotfix 2 instance (Or demonightlylondon) 2. Import the attache dXML files, it contains a bunch of notifications 3. Go to... notification preferencesknown errorloadingindefinitelysupport https://www.nbcsports.com/nhl/news/breaking-kings-voynov-arrested-for-domestic-assault-suspended-indefinitely Updated: Kings' Voynov arrested for domestic assault, suspended indefinitely - NBC Sports Oct 20, 2014 - Was reportedly arrested this morning. for domesticupdatedkingsarrested https://www.eurasiantimes.com/ipl-2021-suspended-indian-premier-league-ipl-postponed-indefinitely/ IPL 2021 Suspended: Indian Premier League (IPL) Postponed Indefinitely Amid Covid-19 Scare May 4, 2021 - The IPL 2021 (Indian Premier League) has been suspended / postponed indefinitely. Having hit hard by the COVID-19 pandemic, the IPL 2021 cancelled indian premier league https://www.wionews.com/sports/nba-miami-heat-suspend-star-forward-jimmy-butler-indefinitely-for-walking-out-of-practice-session-8659806 NBA: Miami Heat suspend star forward Jimmy Butler indefinitely for walking out of practice session Sports, NBA: It's the third time this month the Heat have suspended the 35-year-old Jimmy Butler, who had been expected back on Monday from a two-game ban. https://www.edmsauce.com/2018/11/27/joyryde-pushes-back-album-release-indefinitely-only-days-before-it-goes-live/ JOYRYDE Pushes Back Album Release Indefinitely Only Days Before It Goes Live Sep 27, 2022 - JOYRYDE's upcoming album has been one of the most talked about releases in 2018. A lot of this conversation comes from the album's first single, the album release https://www.odt.co.nz/news/world/us-indefinitely-extends-ceasefire-iran US indefinitely extends ceasefire with Iran | Otago Daily Times Online News Apr 22, 2026 - US President Donald Trump has indefinitely extended a ceasefire with Iran to allow the countries to continue peace talks to end a deadly war that... otago daily times onlineusindefinitelyextendsceasefire https://interfax.com/newsroom/top-stories/98693/ Status of large family established indefinitely, guarantees social support in all of Russia - Putin https://magazine.dagga.za.net/2019/07/30/woman-nabbed-for-drugs/ DOMAIN INDEFINITELY SUSPENDED domainindefinitelysuspended https://community.atlassian.com/forums/Confluence-questions/Confluence-space-loading-indefinitely/qaq-p/1059073 Solved: Confluence space loading indefinitely. Sep 17, 2024 - Solved: Hello, When I try to open a specific space on Chrome Firefox and Edge it loads shows a loader. I tried clearing the browser cache, solvedconfluencespaceloadingindefinitely https://curl.se/mail/lib-2011-01/0157.html Curl: Re: libcurl waits indefinitely for data curlwaitsindefinitelydata https://hoosierstateofmind.com/hoosiers-sophomore-guard-gabe-cupps-undergoes-surgery-out-indefinitely-for-indiana-01jezed4k9xd Hoosiers sophomore guard Gabe Cupps undergoes surgery, out indefinitely for Indiana Dec 13, 2024 - Hoosiers sophomore guard Gabe Cupps undergoes surgery, out indefinitely for Indiana hoosierssophomoreguardgabe https://dagga.za.net/2013/08/10/good-vibes-amp-great-weedlike-if-you-can-relate-winner039s-circlehttpyoutu/ DOMAIN INDEFINITELY SUSPENDED domainindefinitelysuspended https://decrypt.co/365112/morning-minute-bitcoin-passes-78k-as-trump-extends-ceasefire-indefinitely Morning Minute: Bitcoin Passes $78k as Trump Extends Ceasefire Indefinitely - Decrypt Apr 22, 2026 - Bitcoin is ripping past $78K. Kevin Warsh faced off against the Senate. And Kalshi and Polymarket are now both coming for perpetual futures. morning minutebitcoinpasses https://apexnewsgh.com/prez-buhari-and-his-government-suspends-twitter-indefinitely-after-social-platform-blocks-its-presidents-account/ Breaking News: Prez Buhari and his government Suspends Twitter Indefinitely After Social Platform... Jun 4, 2021 - Amidst the growing discontent against Twitter, Nigeria became the first country to suspend the US-based micro-blogging website in the African continent. https://mkecitywire.com/who-were-the-indefinitely-confined-voters-in-milwaukee-ward-138/ Who were the indefinitely confined voters in Milwaukee, Ward 138? - Milwaukee City Wire Oct 30, 2025 - 132 indefinitely confined voters in Milwaukee, Ward 138 automatically received absentee ballots, according to the Wisconsin Elections Commission. https://cpj.org/2012/10/equatorial-guinea-indefinitely-suspends-radio-prog/ Equatorial Guinea indefinitely suspends radio program - Committee to Protect Journalists Oct 23, 2012 - New York, October 23, 2012--Authorities in Equatorial Guinea indefinitely suspended a radio program on a government-controlled outlet during a broadcast on... equatorial guinearadio programindefinitelysuspendscommittee https://penangle.com/tag/unijos-indefinitely-suspends-ongoing-examinations-over-plateau-killings/ Unijos Indefinitely Suspends Ongoing Examinations Over Plateau Killings Archives - Penangle | News... plateau killingsunijosindefinitelysuspendsongoing https://dagga.za.net/2013/06/09/photo-fp-47/ DOMAIN INDEFINITELY SUSPENDED domainindefinitelysuspended https://www.myjoyonline.com/kumasi-edition-of-vigil-for-daddy-lumba-postponed-indefinitely/ Kumasi edition of vigil for Daddy Lumba postponed indefinitely - MyJoyOnline Nov 18, 2025 - The Creative Arts Agency has indefinitely postponed the Kumasi edition of a candlelight vigil in honour of the late highlife legend Daddy Lumba, originally... for daddykumasieditionvigillumba https://notrickszone.com/2020/11/10/electricity-storage-systems-still-woefully-lack-indefinitely-hampering-the-german-green-energy-dream/ Electricity Storage Systems Still Woefully Lack, Indefinitely Hampering The German Green Energy... electricity storage https://magazine.dagga.za.net/2019/04/18/bulky-packaging-number-one-complaint-for-cannabis-retailer/ DOMAIN INDEFINITELY SUSPENDED domainindefinitelysuspended https://forum.speeddemosarchive.com/post/snes_games_that_loop_indefinitely4.html SNES games that loop indefinitely snes gamesloopindefinitely https://www.independentsentinel.com/trump-gives-durham-authority-to-use-classified-information-indefinitely/ Trump gives Durham authority to use classified information indefinitely Dec 23, 2020 - The Trump administration revealed in a memo on Tuesday that last week, they gave John Durham the authority to use classified information indefinitely. He can... to useclassified informationtrumpgivesdurham https://www.metro-magazine.com/news/sacramento-rt-considering-closing-light-rail-line-indefinitely Sacramento RT considering closing light rail line indefinitely | Metro Jun 22, 2016 - The agency opened its $44 million Green Line only four years ago; however, the line currently averages only 440 boardings a day with limited service, and costs... light railsacramentortconsideringclosing https://enclave-nashville.blogspot.com/2007/03/metro-councils-meals-for-deals.html Enclave: Metro Council's "Meals for Deals Reprised" Ethics Bill Deferred Indefinitely metro council https://www.flexiblebenefit.com/blog/grandmothered-plans-permitted-indefinitely Grandmothered Plans Permitted Indefinitely | Flexible Benefit Service LLCGrandmothered Plans... Grandmothered plans are the name commonly used for health insurance plans in the individual and small group markets that were issued after the Affordable Care... flexible benefitplanspermittedindefinitelyservice https://opemsuo.com/parliament-suspended-indefinitely-amid-npp-ndc-impasse/ Parliament Suspended Indefinitely Amid NPP-NDC Impasse | Opemsuo 104.7 Oct 22, 2024 - Exactly seven days after the fifth meeting of the fourth session of Parliament commenced, the Speaker, Rt Hon Alban Sumana Kingsford Bagbin, has adjourned the... parliamentsuspendedindefinitelyamidnpp https://volokh.com/2011/11/30/defense-bill-will-allow-president-to-indefinitely-detain-american-citizens/ Defense bill will allow President to indefinitely detain American citizens - The Volokh... Nov 30, 2011 - H.R. 1540, the National Defense Authorization Act for Fiscal Year 2012, has already passed the House, and is currently before the Senate. One section of the... https://thescreenbrief.com/sxsw-sydney-not-to-return-in-2026-cancelled-indefinitely/ SXSW Sydney Won't Return in 2026, Cancelled Indefinitely - Screen Brief Jan 14, 2026 - Organisers have shared that SXSW Sydney will not return for 2026, with the festival coming to an end after a short three year run. sxsw sydneyreturn https://newclawtimes.com/articles/meta-suspends-mercor-ai-training-data-breach-supply-chain-openai-anthropic/ Meta Indefinitely Suspends $10B AI Training Contractor Mercor After Security Breach Exposes Model... Apr 5, 2026 - Meta suspends $10B AI training contractor Mercor after security breach linked to LiteLLM supply-chain attack https://letsgokings.com/threads/gabe-vilardi-out-indefinitely-enlarged-spleen.509619/ Gabe Vilardi Out Indefinitely - Enlarged Spleen | LGK 2.0 https://www.tsn.ca/nhl/winnipeg-jets-f-gabriel-vilardi-enlarged-spleen-out-indefinitely-1.2090426 enlarged spleengabevilardiindefinitelylgk https://dagga.za.net/2014/06/29/the-silver-code-something-very-very-big-is-about-to-happen/ DOMAIN INDEFINITELY SUSPENDED domainindefinitelysuspended https://mkecitywire.com/who-were-the-indefinitely-confined-voters-in-milwaukee-ward-271/ Who were the indefinitely confined voters in Milwaukee, Ward 271? - Milwaukee City Wire Oct 30, 2025 - 231 indefinitely confined voters in Milwaukee, Ward 271 automatically received absentee ballots, according to the Wisconsin Elections Commission. https://www.thecapital.ng/lagos-to-shut-ladipo-oyingbo-markets-indefinitely/ Lagos To Shut Ladipo, Oyingbo Markets Indefinitely - The Capital NG Sep 16, 2022 - The Lagos Waste Management Authority (LAWMA) has said that both Ladipo and Oyingbo markets would be shut down till further notice from next Thursday. This is... the capitallagosshutmarketsindefinitely https://oldnorthbanter.com/2015/01/24/theo-pinson-indefinitely-tar-heels/ Theo Pinson Out Indefinitely for Tar Heels Jan 24, 2015 - Theo Pinson of the North Carolina Tar Heels broke his fifth metatarsal in his left foot against Wake Forest. This adds growing list of injuries to the Heels theopinsonindefinitelytarheels https://dagga.za.net/2016/04/20/retweeted-dagga-magazine-daggamagazinehappy-420-dagga-day-daggamovement-daggaunion-daggashop-one-love/ DOMAIN INDEFINITELY SUSPENDED domainindefinitelysuspended https://puckprose.com/2019/04/21/washington-capitals-tj-oshie-indefinitely-fractured-clavicle/ Capitals forward T.J. Oshie out indefinitely with fractured clavicle Apr 21, 2019 - The Washington Capitals will have to win back-to-back Stanley Cups without star forward T.J. Oshie, who is out indefinitely with a fractured clavicle. capitalsforwardjoshieindefinitely https://www.momusicdate.com.ng/2021/06/nigeria-says-twitter-ban-to-remain.html Nigeria Says Twitter Ban to Remain Indefinitely Until Tech Giant Shows Remorse The suspension of the operation of American microblogging company, Twitter in Nigeria by the federal government is to remain indefinitely until the co twitter ban https://thelogicalindian.xyz/news/cryptsy-bitcoin-exchange-announces-massive-theft-shuts-indefinitely Cryptsy Bitcoin Exchange Announces Massive Theft And Shuts Down Indefinitely | BITCOIN NEWS Troubled bitcoin and altcoin exchange Cryptsy made an announcement overnight that may have shocked many or maybe not because of all the problems they have been... bitcoin exchangeshuts downcryptsyannouncesmassive https://www.hiltonaudio.com/blog/ce-certification-issues-stop-hilton-sales-in-europe-indefinitely CE Certification Issues Stop Hilton Sales In Europe - "Indefinitely" - Hilton Audio Products While I am generally pleased with the progress we are making with Hilton Audio in the USA and most of the rest of the world, we have hit a fairly significant... ce certificationin europeissuesstophilton https://four20post.com/2020/06/chicago-marijuana-dispensaries-close-indefinitely/ Chicago Marijuana Dispensaries Close Indefinitely | Four20 Post marijuana dispensarieschicagocloseindefinitelypost https://lokmarg.com/sc-on-shaheen-bagh-public-places-cant-be-occupied-indefinitely/ SC On Shaheen Bagh: Public Places Can't Be Occupied Indefinitely - Lokmarg Oct 7, 2020 - The Supreme Court on Wednesday, while pronouncing its verdict on a batch of petitions against the Shaheen Bagh protests, held that public places and roads... shaheen baghpublic places https://www.thaiexaminer.com/thai-news-foreigners/2020/03/10/kasikorn-bank-foreign-exchange-services-coronavirus-disease/ Kasikorn Bank indefinitely suspends all retail foreign exchange services due to kingdom's virus... Mar 21, 2020 - BANGKOK: The bank, in a statement on Sunday, said it was taking the step following the official announcement by the Ministry of Public Health on Thursday... https://knowledge.broadcom.com/external/article/298579/during-a-tkgi-cluster-upgrade-the-worker.html During a TKGI cluster upgrade the worker node hangs indefinitely the workertkgiclusterupgradenode https://www.nfl.com/news/atlanta-falcons-sean-weatherspoon-out-indefinitely-0ap1000000226708 Atlanta Falcons' Sean Weatherspoon out indefinitely Atlanta Falcons linebacker Sean Weatherspoon suffered an open dislocated finger at Monday's practice. He and Julio Jones will miss Thursday's preseason game... atlanta falconsseanweatherspoonindefinitely https://www.latintimes.com/peru-indefinitely-shuts-machu-picchu-amid-anti-government-protests-541334 Peru Indefinitely Shuts Machu Picchu Amid Anti-Government Protests Jan 23, 2023 - The tourist spot of Machu Picchu has been closed to the public and to tourists on Saturday for their protection as protests in Peru against the government... machu picchuperuindefinitelyshutsamid https://balkin.blogspot.com/2008/06/tea-leaves-part-ii-who-may-president.html?showComment=1213329540000 Balkinization: Tea Leaves Part II -- Who May the President Detain Indefinitely? A group blog on constitutional law, theory, and politics tea leavespart iithe presidentbalkinization