Robuta

https://github.com/spatie/laravel-mobile-pass GitHub - spatie/laravel-mobile-pass: Generate mobile passes for iOS and Android · GitHub Generate mobile passes for iOS and Android. Contribute to spatie/laravel-mobile-pass development by creating an account on GitHub. ios and androidgithublaravelmobilepass https://querverweis.com/ Webseiten im Test 2026 - Laravel Bist du bereit für DIESE Links? webseitenimtestlaravel https://livewire.laravel.com/ Livewire | Laravel Livewire A full-stack framework for Laravel that takes the pain out of building dynamic UIs. livewirelaravel https://www.honeybadger.io/for/laravel/?affiliate=vxYuzl Laravel Error Tracking & Application Monitoring - Honeybadger Full-stack Laravel Monitoring: Error tracking, performance monitoring, logging, and more in one powerfully simple platform. Try our free developer plan! error trackingapplication monitoringlaravelhoneybadger https://laravelshift.com/ Laravel Shift - the automated way to upgrade Laravel applications Laravel Shift - the automated way to upgrade Laravel applications. Upgrade Laravel applications all the way from Laravel 4.2 to the latest version of Laravel. laravelshiftautomatedwayupgrade https://masteringlaravel.io/daily/2026-04-23-dont-take-patterns-too-far Don't take patterns too far | Mastering Laravel Consistency isn't an absolute good takepatternsfarmasteringlaravel https://github.com/cloudinary-community/cloudinary-laravel/ GitHub - cloudinary-community/cloudinary-laravel: Laravel SDK for Cloudinary · GitHub Laravel SDK for Cloudinary. Contribute to cloudinary-community/cloudinary-laravel development by creating an account on GitHub. githubcloudinarycommunitylaravelsdk https://stephenreescarter.net/laravel-security-reviews/ Laravel Security Reviews – Stephen Rees-Carter Dec 16, 2024 - Are you concerned about the security of your application, or worried about potential vulnerabilities and threats that could compromise your sensitive data, but... security reviewslaravelstephencarter https://jump24.co.uk/services/application-development Custom Application Development UK | Laravel & Vue.js | Jump24 custom applicationvue jsdevelopmentuklaravel https://certificates.dev/laravel Laravel Certification - Certificates.dev Validate your Laravel skills through real-world coding challenges and hands-on certification exams built by Laravel experts. laravelcertificationcertificatesdev https://businessoflaravel.com/ The Business of Laravel Short, powerful interviews with business leaders working with and within the Laravel ecosystem--about business, tech, and more! Hosted by Matt Stauffer. the businesslaravel https://laravelcreatorspotlight.transistor.fm/ Laravel Creator Spotlight Interviews with creators making cool things in Laravel creator spotlightlaravel https://builtwithlaravel.com/ Built with Laravel A curated list of companies and organizations building with Laravel. built withlaravel https://www.amezmo.com/ Amezmo: Managed PHP hosting | Managed PHP Hosting for Laravel, Craft CMS, and Drupal Managed PHP app hosting for your applications. Focus on infrastructure, not code. php hostingcraft cmsmanagedlaraveldrupal https://bagisto.com/en/ Bagisto - Laravel eCommerce Platform | Free & Open Source An Open source Laravel eCommerce platform for building marketplaces, mobile apps, blockchain, and headless commerce. ecommerce platformopen sourcebagistolaravelfree Sponsored https://www.fanvue.com/mila_lerue Mila LeRue - Fanvue Come to play with me? Let me show you something you've never seen before babe...I'm waiting for you! https://krayincrm.com/ Free Open Source CRM Software | Laravel CRM - Krayin Krayin is an open source CRM built on Laravel. It helps manage leads, customers, and sales with customizable features that scale with your business. open source crmfreesoftwarelaravel https://masteringlaravel.io/daily/2026-04-24-video-how-to-test-that-a-model-wasnt-changed How to test that a model wasn't changed | Mastering Laravel One option I like to use how to testmodelchangedmasteringlaravel https://nomadicsoft.io/ Web & Mobile App Development | Laravel | Vue | React | Nomadic Soft mobile app developmentweblaravelvuereact https://securinglaravel.com/ Securing Laravel The essential security resource for Laravel developers. securinglaravel https://masteringlaravel.io/daily/2026-04-22-republished-cloudflare-laravel-and-tls Cloudflare, Laravel, and TLS | Mastering Laravel Double check this setting to save yourself some trouble cloudflarelaraveltlsmastering https://practicallaravelsecurity.com/ Practical Laravel Security - Secure Your Laravel Apps A hands-on practical Laravel Security course that uses interactive hacking exercises to teach you how to keep your applications secure. Because learning... your appspracticallaravelsecuritysecure https://laravelpodcast.com/ The Laravel Podcast The Laravel Podcast brings you Laravel and PHP development news and discussion. laravelpodcast https://www.linkedin.com/company/laravel-news Laravel News | LinkedIn Laravel News | 143,175 followers on LinkedIn. Your news source for the Laravel PHP Framework | Laravel News keeps you up to date on everything going on in the... laravel newslinkedin https://acquaintsoft.com/hire-laravel-developers Hire Laravel Developers | Laravel Partner | $22/hr | Acquaint Softtech hire laravel developersacquaint softtechpartnerhr https://masteringlaravel.io/codereview?ref=ln Expert Laravel Code Review Service | Mastering Laravel Get your Laravel codebase reviewed by experts with 10+ years of experience. Identify issues, get prioritized recommendations, and build a foundation for... code reviewexpertlaravelservicemastering https://xcloud.host/ xCloud- Next-Gen Managed Hosting & Server Management for WordPress, Laravel & PHP Applications next genmanaged hostingserver managementfor wordpressxcloud https://laravel-news.com/partner/acquaint-softtech Acquaint Softtech - Laravel News Acquaint Softtech offers AI-ready Laravel developers who onboard in 48 hours at $3000/Month with no lengthy sales process and a 100 percent money-back... acquaint softtechlaravel news https://github.com/harris21/ship-ai-with-laravel GitHub - harris21/ship-ai-with-laravel: Build a production-ready AI-powered customer support... Build a production-ready AI-powered customer support platform with Laravel's official AI SDK. An 11-episode video series covering agents, tools, embeddings,... customer supportgithubshipailaravel https://github.com/filamentphp/filament GitHub - filamentphp/filament: A powerful open-source UI framework for Laravel • Build and ship... open sourceui frameworkgithubfilamentpowerful https://freek.dev/3108-generate-apple-wallet-and-google-wallet-passes-from-laravel Generate Apple and Google Wallet passes from Laravel - Freek Van der Herten's blog on Laravel, PHP... Apr 23, 2026 - A mobile pass is that thing in your iPhone's Wallet app. A boarding pass, a concert ticket, a coffee loyalty card, a gym membership. Apple calls them passes.... google walletgenerateapplepasseslaravel https://catchadmin.com/post/2026-04/gpt-55-agentic-ai-release GPT-5.5 开启更强的智能体工作方式 - CatchAdmin 后台管理系统框架|企业级 PHP 开源后台|PHP 后台框架|PHP 后台管理框架|Laravel 后台 CatchAdmin 是一款后端基于 PHP Laravel,前端基于 Vue 的面向企业级项目的 PHP 开源后台管理框架。底层基于 PHP Laravel 构建,结合 Vue 实现前后端分离。框架提供完善的模块化设计、权限控制和一键安装器,帮助开发者快速搭建稳定的 PHP 后台与 Laravel... gptphplaravel https://redberry.international/mailbox-for-laravel-email-testing/ Mailbox for Laravel: A Better Way to Test Emails in Laravel Mailbox for Laravel is a local email testing package that captures outgoing messages and lets you preview them in a clean inbox, no Mailtrap, no extra setup. mailboxlaravelbetterwaytest Sponsored https://www.deeper.com/ DEEPER: Bold and Sensual 4K Experiences with a Kinky Twist DEEPER invites you into a world of passion, power, and sensual discovery. Explore elegant encounters with stunning women and light kink themes... https://www.youtube.com/c/Laravel-news Laravel News - YouTube We’ve been covering Laravel longer than most frameworks have existed. This channel is where we break down new releases, spotlight packages worth your attenti... laravel newsyoutube https://laravel-news.com/why-your-livewire-dashboard-jumps-and-how-to-fix-it-laravel-in-practice-ep18 Why Your Livewire Dashboard Jumps (And How to Fix It) - Laravel In Practice EP18 - Laravel News Feb 6, 2026 - Your real-time dashboard updates, but every new order makes the whole page jump. In this episode, I show you how to combine Livewire's skipRender with... how to fixin practicelivewiredashboardjumps https://stackoverflow.com/questions/79922344/how-to-capture-the-payment-of-an-order-using-paypal-checkout-api-on-laravel-get php - How to capture the payment of an order using paypal checkout API on Laravel? Getting 400 Bad... I'm integrating the PayPal API using its endpoint via Laravel Http requests. I've already done the Create Order function and it works: public function... how topaypal checkoutphpcapturepayment https://cloud.laravel.com/cloud-vs-heroku Laravel Cloud vs. Heroku Compare Laravel Cloud and Heroku. Cloud offers fully managed Laravel-native infrastructure with easy scaling, while Heroku is a general-purpose PaaS platform. laravel cloudvsheroku https://solarise.dev/ Digital Architect | Laravel & Enterprise WordPress - SOLARISE.DEV Senior technical partner based in Edinburgh. We build scalable Laravel applications and secure enterprise WordPress sites for businesses that can't afford... enterprise wordpressdigitalarchitectlaraveldev https://laravel-news.com/custom-middleware-for-query-performance-monitoring-and-optimization-in-laravel-with-mongodb Build Custom Middleware for Query Performance Monitoring and Optimization in Laravel with MongoDB -... Apr 21, 2026 - Learn how to build a lightweight query performance monitoring system using Laravel middleware and MongoDB's PHP driver command subscriber to track slow... custom middlewarequery performancebuildmonitoringoptimization https://status.laravel.cloud/ Laravel Cloud Status Welcome to Laravel Cloud's home for real-time and historical data on system performance. laravel cloudstatus https://laravelshift.com/shift-build Laravel Shift - Authorizing the Shift Build Documentation on configuring a Composer auth.json file to authorize building your project so Shift can run more intelligently and precisely. the buildlaravelshift https://laravel-news.com/laravel-12-46-0 Laravel 12.45.1, 12.45.2, and 12.46.0 Released - Laravel News Jan 8, 2026 - Laravel released three new framework versions on January 7, 2026, bringing valuable new array and collection helpers, enhanced Gate authorization with enum... 1 2laravelreleasednews https://tighten.com/ Tighten | Software Development for Web and Mobile | Laravel, Livewire, Vue.js, and React Tighten is a software development firm specializing in Laravel, Livewire, Vue.js, and React. software developmentfor webvue jstightenmobile https://laravel-news.com/laravel-12-49-0 `hasSole()` Collection Method in Laravel 12.49.0 - Laravel News Jan 28, 2026 - Laravel v12.49.0 introduces a new hasSole() collection method for checking if a collection contains exactly one matching item, along with subquery between... collectionmethodlaravelnews https://laravel-news.com/composer-296-fixes-two-perforce-command-injection-vulnerabilities Composer 2.9.6 Fixes Two Perforce Command Injection Vulnerabilities - Laravel News Apr 15, 2026 - Composer 2.9.6 and 2.2.27 LTS fix two Perforce VCS driver command injection vulnerabilities that could lead to arbitrary command execution. Update immediately. command injectionlaravel newscomposerfixestwo Sponsored https://www.blackedraw.com/ BLACKED RAW: Unfiltered Encounters with Powerful Men in 4K https://www.freelancer.com/jobs/laravel/ Laravel Jobs for April 2026 | Freelancer World's largest website for Laravel Jobs. Find $$$ Laravel Jobs or hire a Laravel Developer to bid on your Laravel Job at Freelancer. 12m+ Jobs! laravel jobsapril 2026freelancer https://laravel-news.com/spatie-shares-their-coding-guidelines-as-ai-skills Spatie Shares Their Coding Guidelines as AI Skills - Laravel News Apr 16, 2026 - Spatie's battle-tested coding guidelines as AI skills, compatible with Laravel Boost and skills.sh. coding guidelinesai skillslaravel newsshares https://auth0.com/docs/quickstart/webapp/laravel/interactive Add Login to Your Laravel Application - Auth0 Docs This guide demonstrates how to integrate Auth0 with a new or existing Laravel application using the Auth0 Laravel SDK. auth0 docsaddloginlaravelapplication https://demo.backpackforlaravel.com/ Backpack for Laravel backpacklaravel https://certificates.dev/blog/how-the-laravel-service-container-actually-works-under-the-hood How the Laravel Service Container Actually Works Under the Hood - Certificates.dev Go beyond the “magic” of Laravel’s dependency injection. Learn how the service container works under the hood and why it’s essential for building clean,... laravelservicecontaineractuallyworks https://masteringlaravel.io/ From Competent to Confident | Mastering Laravel A collection of resources to make you a better Laravel developer confidentmasteringlaravel https://masteringlaravel.io/partners Partners | Mastering Laravel Mastering Laravel's trusted partners partnersmasteringlaravel https://www.coastercms.org/ Coaster CMS - Beacon Enabled, Laravel Content Management System Coaster content management system, a beacon enabled Laravel CMS with physical web integration. Coaster is easy to use and extremely flexible. content management systemcoastercmsbeaconenabled https://www.luckymedia.dev/laravel-development-agency Laravel Development Agency | Laravel Company - Lucky Media Lucky Media is a Laravel development agency in Dallas, TX. 10+ years building scalable web apps, APIs, and admin dashboards for US startups and enterprises. laravel developmentlucky mediaagencycompany https://freek.dev/music Music - Freek Van der Herten's blog on Laravel, PHP and AI Freek Van der Herten writes about Laravel, PHP and AI. Co-owner of Spatie, maintainer of 300+ open source packages with over 2 billion downloads. musicfreekvanderherten https://taenzer.de/ tänzer:digital - Digitalagentur für WordPress, Laravel, NextCloud und Hosting aus Bonn Wir planen | designen | programmieren | hosten individuelle digitale Lösungen. Im Herzen von Bonn erstellen wir datenschutzkonforme Weblösungen mit WordPress… digitalwordpresslaravelnextcloudund https://laravel-news.com/prism-workers-ai-a-cloudflare-workers-ai-provider-for-prism-php Prism Workers AI — A Cloudflare Workers AI Provider for Prism PHP - Laravel News Mar 23, 2026 - The Prism Workers AI package adds a Cloudflare Workers AI provider for Prism PHP and Laravel AI SDK, with support for text generation, embeddings, streaming,... workers ailaravel newsprismcloudflareprovider https://certificates.dev/laravel/legal/privacy-policy Legal - Laravel - Certificates.dev Validate your Laravel skills through real-world coding challenges and hands-on certification exams built by Laravel experts. legallaravelcertificatesdev https://cloud.laravel.com/docs/changelog Changelog - Laravel Cloud See the latest Laravel Cloud updates, improvements, and platform changes. laravel cloudchangelog https://freek.dev/search Search - Freek Van der Herten's blog on Laravel, PHP and AI Freek Van der Herten writes about Laravel, PHP and AI. Co-owner of Spatie, maintainer of 300+ open source packages with over 2 billion downloads. searchfreekvanderherten https://laravel-news.com/@amas Ahmad - Laravel News laravel newsahmad https://roots.io/acorn/ Integrate WordPress & Laravel | Acorn | Roots WordPress Laravel integration framework. Bring Blade templating, database migrations, routing, and Laravel’s developer tools to WordPress. integratewordpresslaravelacornroots https://laravel-news.com/ Laravel News Laravel News is the official blog of Laravel. Every day bringing you the latest news, tutorials, and packages for the framework. laravel news https://www.luckymedia.dev/case-studies/streamlining-hosting-and-domain-services Laravel App Cuts Support Tickets 40% - Lucky Media Chillidog's legacy WHMCS interface was killing satisfaction. We built a Laravel frontend layer: 40% fewer tickets, 70% faster, 25% happier customers. support ticketslucky medialaravelappcuts Sponsored https://www.secrets.ai/ Secrets AI - #1 Realistic AI Girlfriend Website for Chatting Chat 24/7 with realistic AI Girlfriend and enjoy 100+ Fantasies. Secrets AI is the best AI girlfriend website for mutual fun & personal AI companion bonding.... https://www.zend.com/blog/cakephp-vs-laravel CakePHP vs. Laravel: Choosing the Best PHP Framework | Zend CakePHP vs. Laravel: Where CakePHP excels in simplicity and speed, Laravel offers scalability and advanced features. Find your best option in this expert blog. the bestcakephpvslaravelchoosing https://masteringlaravel.io/books Books by Joel and Aaron | Mastering Laravel A collection of resources to make you a better Laravel developer booksjoelaaronmasteringlaravel https://laravel-news.com/laravel-12-48-0 Query Builder Expression Aliases in Laravel 12.48 - Laravel News Jan 20, 2026 - Laravel v12.48.0 introduces query builder expression aliases, new batch lifecycle events, enhanced JSON decoding options for HTTP responses, and a... query builderexpressionaliaseslaravelnews https://laravel-news.com/time-based-sharding-in-pest-v4-6-0 Time-Based Sharding in Pest v4.6.0 - Laravel News Apr 14, 2026 - Pest v4.6.0 introduces time-based test sharding, allowing CI jobs to distribute tests by actual execution time for more balanced parallel runs. 6 0laravel newstimebasedsharding https://laravel-news.com/popular-laravel-packages Trending Laravel Packages The most popular Laravel Packages laravel packagestrending Sponsored https://www.flirtbate.com/login Flirtbate: #1 Adult Chat & Live Sex Cam Platform Join Flirtbate, the #1 adult chat platform for live sex video call experience. Connect with sexy models, enjoy real-time interactions, and explore private... https://nicodevs.com/ Nico Devs · Laravel, Vue & Nuxt Developer Lead Programmer at Tighten and former VueSchool engineer with 20 years of experience building web applications with Laravel, Vue.js, Nuxt, and Tailwind.... nicodevslaravelvuenuxt Sponsored https://cams.com/ Cams.com - Free Sex Cams, Live Sex Chat 24/7 Live sex cams, watch and go one on one with your favorite model at Cams.com 🔥 Join free. https://www.angelcruz.dev/ Desarrollador PHP Senior | Laravel, WordPress y Next.js Desarrollador PHP senior: Laravel, WordPress y Next.js. Aplicaciones rápidas, mantenibles y que mejoran conversiones y SEO. next jsdesarrolladorphpseniorlaravel https://themsaid.com/laravel-queues-in-action Laravel Queues in Action Learn how to use the queue system to make your applications faster and more reliable while reducing running costs. in actionlaravelqueues https://sparta67.nl/ Laravel laravel https://johnrudolphdrexler.com/ Laravel laravel https://zako.dev/ Zak | Full Stack Dev Laravel / VueJS / QuasarFramework Tips, tricks and thoughts from a spaghetti-code developer. full stackzakdevlaravelvuejs https://freek.dev/ Freek Van der Herten's blog on Laravel, PHP and AI Freek Van der Herten writes about Laravel, PHP and AI. Co-owner of Spatie, maintainer of 300+ open source packages with over 2 billion downloads. freekvanderhertenblog Sponsored https://darlink.ai/ DarLink AI: Free AI Girlfriend Generator | Chat, Photos & Video Create your ideal AI Girlfriend with DarLink AI. Customize her look and personality, chat naturally, and enjoy personalized photos, videos, and voice for a... https://www.algolia.com/developers/laravel-php-framework PHP Laravel framework API client for Search | Algolia Official Algolia search integration for PHP Laravel framework. Index your data, configure your search, add analytics and much more. api clientphplaravelframeworksearch https://laravelshift.com/faq Laravel Shift - Frequently Asked Questions Answers to frequently asked questions on how to use Laravel Shift and how Laravel Shift works. frequently asked questionslaravelshift https://github.com/area17/twill GitHub - area17/twill: Twill is an open source CMS toolkit for Laravel that helps developers... Twill is an open source CMS toolkit for Laravel that helps developers rapidly create a custom admin console that is intuitive, powerful and flexible. Chat with... open source cmsgithubtwilltoolkitlaravel https://laravel-news.com/package/laravel-sanctum Laravel Sanctum provides a featherweight authentication system for SPAs and simple APIs. laravel/sanctum - Laravel Sanctum provides a featherweight authentication system for SPAs and simple APIs. laravelsanctumprovidesfeatherweightauthentication https://zad.bet/ Laravel laravel https://securinglaravel.com/tag/tips/ Security Tips - Securing Laravel Weekly security tips that cover the simpler topics, configuration options, tricks, updates, and anything else security related you need to be aware of. security tipssecuringlaravel https://stackoverflow.com/questions/79931563/best-approach-for-handling-large-file-uploads-and-zip-generation-in-laravel php - Best approach for handling large file uploads and ZIP generation in Laravel? - Stack Overflow I’m building a Laravel 12 folder organizer where users may upload large folders (many files / large sizes), and I categorize files by extension and generate a... file uploadsstack overflowphpbestapproach https://redberry.international/laravel-testing-strategies/ A Practical Guide to Testing Laravel Applications with Pest Learn how to build reliable, scalable Laravel applications with a comprehensive testing strategy. Redberry shares how we use Pest, automated CI/CD workflows,... practical guidetestinglaravelapplicationspest https://laravel-news.com/mongodb-vector-search-in-laravel-finding-the-unqueryable MongoDB Vector Search in Laravel: Finding the Unqueryable - Laravel News Feb 17, 2026 - Learn how to implement MongoDB Vector Search in Laravel to find results by semantic meaning instead of keyword matching, using Voyage AI embeddings and... vector searchmongodblaravelfindingnews https://laravel-vite.innocenzi.dev/ Laravel Vite - Vite integration for the Laravel framework | Laravel Vite Vite integration for the Laravel framework the frameworklaravelviteintegration https://larajobs.com/full-time-jobs Laravel + Full Time Jobs - LaraJobs Find the best Full Time jobs at top companies that are hiring now. full time jobslaravel https://laravel-news.com/@ylynfatt Yannick Lyn Fatt - Laravel News Yannick Lyn Fatt bio yannick lyn fattlaravel news https://madeinevolve.com/projects/pollini Pollini: Custom Laravel eCommerce | Evolve pollinicustomlaravelecommerceevolve https://larajobs.com/laravel-consultants Laravel Consultants - LaraJobs Discover the best Laravel consultants with options for every budget. laravelconsultants https://tighten.com/privacy-policy/ Tighten | Software Development for Web and Mobile | Laravel, Livewire, Vue.js, and React Tighten is a software development firm specializing in Laravel, Livewire, Vue.js, and React. software developmentfor webvue jstightenmobile https://www.curotec.com/services/technologies/php/ PHP Development Services by Official Laravel Partners | Curotec Apr 7, 2026 - Our engineers build and modernize PHP applications across Laravel, Symfony, and legacy codebases with the depth of an official Laravel partner. php development servicesofficiallaravelpartnerscurotec Sponsored https://www.cheekycrush.com/ CheekyCrush https://packagist.org/packages/onecentlin/laravel-adminer onecentlin/laravel-adminer - Packagist.org Laravel Adminer Database Manager laraveladminerpackagist https://laravel-news.com/event/laravel-live-uk-2026 Laravel Live UK 2026 - Laravel News Laravel Live UK is a two-day conference on 18 - 19 June 2026. Join over 350 Laravel and PHP enthusiasts for inspirational talks, engaging networking and... 2026 newslaravelliveuk https://laravel-news.com/log-user-activity-in-your-laravel-app-with-activity-log-v5 Log User Activity in Your Laravel App with Activity Log v5 - Laravel News user activityloglaravelappv5 https://cloud.laravel.com/docs/resources/databases/laravel-mysql Laravel MySQL - Laravel Cloud Fully managed MySQL database. laravelmysqlcloud https://laravelshift.com/docker Laravel Shift - Shift for Docker Run any Shift locally using Docker to upgrade your Laravel, Livewire, Lumen, PHP, and Tailwind projects. laravelshiftdocker https://laravel-news.com/laravel-mobile-pass-generate-apple-wallet-and-google-wallet-passes Laravel Mobile Pass: Generate Apple Wallet and Google Wallet Passes - Laravel News Apr 24, 2026 - Spatie's Laravel Mobile Pass package lets you generate and push live updates to Apple Wallet and Google Wallet passes directly from your Laravel app. apple walletlaravelmobilepassgenerate https://laravel-news.com/ship-ai-with-laravel-stop-your-ai-agent-from-guessing Ship AI with Laravel: Stop Your AI Agent from Guessing - Laravel News Apr 8, 2026 - Your support agent talks, classifies tickets, but when a customer asks shipailaravelstopagent https://masteringlaravel.io/daily Daily Laravel Tips Archive | Mastering Laravel Browse past tips and tricks published in the Mastering Laravel daily newsletter dailylaraveltipsarchivemastering https://approximated.app/guides/laravel-custom-domains-guide/ Laravel Custom Domains Guide A tutorial guide for adding custom domains as a feature to your Laravel app, with an example code repo. custom domainslaravelguide