Robuta

https://expired.yr.staging-test-certs.letsencrypt.org/ expired.yr.staging-test-certs.letsencrypt.org Website for compatibility testing. expiredyrstagingtestcerts https://builds.robur.coop/job/dns-letsencrypt?platform=freebsd-14 Job dns-letsencrypt on freebsd-14 jobdnsletsencryptfreebsd https://autoinstall.plesk.com/LETSENCRYPT_0.0.1/ Index of /LETSENCRYPT_0.0.1 index ofletsencrypt https://forum.howtoforge.com/threads/letsencrypt-not-working-centos-7-4-perfect-server-guide.77335/ letsencrypt not working Centos 7.4 perfect server guide | Howtoforge - Linux Howtos and Tutorials Hi All, I just installed ISPConfig via this guide:... not workingserver guideletsencryptcentosperfect https://forum.ts3musicbot.net/viewtopic.php?f=37&t=2894&sid=2c51c05eb3f711c240e5184a38f2903d [BETA] Secure webinterface with letsencrypt+certbot SSL/HTTPS certificate - TS3MusicBot Forum https certificatebetasecurewebinterfaceletsencrypt https://rubygems.org/gems/itamae-plugin-recipe-letsencrypt itamae-plugin-recipe-letsencrypt | RubyGems.org | your community gem host your communitypluginrecipeletsencryptrubygems https://forum.proxmox.com/threads/letsencrypt-root-certificate.98426/ Letsencrypt root certificate | Proxmox Support Forum Hi, I have a problem receiving emails from a small number of servers, no emails make it through and i get the following message in the syslog: warning: TLS... proxmox supportletsencryptrootcertificateforum https://trailhead.salesforce.com/fr/trailblazer-community/feed/0D54V00007T6JobSAF Is it possible to use letsencrypt | Salesforce Trailblazer Community https://letsencrypt.org/ is a Certificate Authority (CA) that provides free SSL Certs. I have a Domain in Salesforce that I'd like to get a SSL trailblazer communitypossibleuseletsencryptsalesforce https://opam.ocaml.org/packages/letsencrypt-dns/letsencrypt-dns.2.1.0/ opam - letsencrypt-dns.2.1.0 The homepage of opam, a package manager for OCaml opamletsencryptdns https://www.truenas.com/community/tags/letsencrypt/ letsencrypt | TrueNAS Community letsencrypttruenascommunity https://forums.koozali.org/index.php/topic,54460.0.html letsencrypt challenge not completing letsencrypt challenge not completing letsencryptchallengecompleting https://www.realgreatdevs.com/hire-developers/letsencrypt Hire Letsencrypt Developers | 180+ Verified Engineers | RealGreatDevs | RealGreatDevs Find and hire Letsencrypt developers from our database of 180+ verified engineers. View actual GitHub code, not just resumes. Direct contact info included. hireletsencryptdevelopersverifiedengineers https://hashnode.com/forums/thread/letsencrypt-vs-paid-certificate-authorities-what-do-you-use-these-days-for-your-production-apps/comment/5836d5ebddfa96eb7c5d4bf3 Comment by TheSheriff on "LetsEncrypt vs Paid Certificate Authorities - What do you use these days... This is definitely a no-brainer. LetsEncrypt is free, backed by google and has the same level of security as other, Paid for, CA's. Especially for startups certificate authoritiesthese dayscommentletsencryptvs https://community.f5.com/discussions/technicalforum/big-iq--letsencrypt-wildcard/336362 Big-IQ + LetsEncrypt wildcard | DevCentral bigiqletsencryptwildcarddevcentral https://community.mailcow.email/d/2812-ssl-with-letsencrypt/8 SSL with letsencrypt - mailcow community Hi there, i have problem setup SSL for Mailcow UI and SOGo. Have running linux debian where is installed apache2. There is running main website with domain.... sslletsencryptmailcowcommunity https://forum.netgate.com/topic/128103/advice-and-info-request-squidguard-reverse-proxy-with-ldap-and-letsencrypt Advice and info request: Squidguard reverse proxy with LDAP and Letsencrypt | Netgate Forum Mar 12, 2018 - I'm in need of a reverse proxy that hits the criteria below, can this be done with Squid/Squidgard? Is squid easy to work with on pfSense or should I just lo... info requestreverse proxyadvicesquidguardldap https://meta.discourse.org/t/letsencrypt-setup-does-not-seem-to-be-able-to-find-its-files-on-first-rebuild/59901?tl=en Letsencrypt setup does not seem to be able to find its files on first rebuild - Bug - Discourse Meta Mar 26, 2017 - I've seen this twice about a month ago, and just had it again when I was setting up a brand new forum using the guided discourse-setup wizard. I started a new... does notto beletsencryptsetupseem https://www.tobymackenzie.com/blog/2022/12/08/letsencrypt-log-failure-string/ Letsencrypt log failure string - Blog - toby letsencryptlogfailurestringtoby https://dev.to/simplecto/my-configuration-for-traefik-2-0-docker-and-letsencrypt-285d My configuration for Traefik 2.0, Docker, and LetsEncrypt - DEV Community My guess is that if you are here then you already know what you are looking for. For the benefit of e... Tagged with reverseproxy, traefik, docker, letsencrypt. dev communityconfigurationtraefikdockerletsencrypt https://jorgedelacruz.uk/2022/03/18/veeam-how-to-install-a-valid-ssl-certificate-lets-encrypt-for-the-new-restore-portal-on-veeam-backup-for-microsoft-365-v6/vbm365-letsencrypt-006/ vbm365-letsencrypt-006 - The Blog of Jorge de la Cruz the blogde laletsencryptjorgecruz https://forum.opnsense.org/index.php?topic=8865 Exporting LetsEncrypt Certificates in Automated way Exporting LetsEncrypt Certificates in Automated way exportingletsencryptcertificatesautomatedway https://community.nethserver.org/t/letsencrypt-node-certificate-renews-but-type-is-requested/26445 LetsEncrypt node certificate renews, but type is "Requested" - Support - NethServer Community Oct 9, 2025 - I had LE certs apparently expire, as mail quit syncing due to certificate error. Cluster-admin also had cert error opening the browser page. Loading the TLS... letsencryptnodecertificaterenewstype https://fedoramagazine.org/gitlab-pelican-lets-encrypt-secure-blog/letsencrypt-new-domain/ letsencrypt-new-domain - Fedora Magazine new domainletsencryptfedoramagazine https://gist.github.com/vidia/fbef2ee643b23848d8b24211d5860b78?permalink_comment_id=3738633 Example, working, NGINX config for proxying to Unifi Controller software and using letsencrypt.... Example, working, NGINX config for proxying to Unifi Controller software and using letsencrypt. Includes websocket fix. - nginx-unificontroller.conf nginx configexampleworkingproxyingunifi https://www.drupal.org/node/2991769 When I disable a site that has letsencrypt enabled I cannot restart the webserver [#2991769] |... Aug 23, 2018 - apache on aegir-server could not be restarted. AH00526: Syntax error on line 13 of /var/aegir/config/server_master/apache/vhost.d/t11.onebayview.com:... disablesiteletsencryptenabledcannot