Robuta

https://www.ncbi.nlm.nih.gov/protein/271499181?report=GenPept Record removed: luciferase family oxidoreductase, group 1 [Dickeya dadantii Ech586] - Protein - NCBI https://umu.diva-portal.org/smash/record.jsf?pid=diva2:636018 Transcription Factor Activity Analysis Using a Functional Multiplex Gaussia Luciferase-Based... transcription factoractivityanalysisusing https://www.ncbi.nlm.nih.gov/Structure/pdb/5KYT 5KYT: Structure of Photinus pyralis Luciferase red light emitting variant Luciferin 4-monooxygenase1,2-ETHANEDIOL5'-O-[N-(DEHYDROLUCIFERYL)-SULFAMOYL] ADENOSINE photinus pyralisred lightstructureluciferasevariant https://foliabiologica.lf1.cuni.cz/keywords/luciferase/ Keyword luciferase | Folia Biologica keywordluciferasefoliabiologica https://ocw.mit.edu/courses/7-15-experimental-molecular-genetics-spring-2015/resources/mit7_15s15_primerscloning/ Primers for GFP and Luciferase cloning | Experimental Molecular Genetics | Biology | MIT... This file contains information regarding primers for GFP and luciferase cloning. molecular geneticsprimersgfpluciferase https://pubmed.ncbi.nlm.nih.gov/15189096/ Optical imaging of Renilla luciferase, synthetic Renilla luciferase, and firefly luciferase... We have recently demonstrated that Renilla luciferase (Rluc) is a promising bioluminescence reporter gene that can be used for noninvasive optical imaging of... optical imagingluciferasesyntheticfirefly https://pubchem.ncbi.nlm.nih.gov/bioassay/1797989 AID 1797989 - ER-alpha Radioligand Binding Assay and ERE-Luciferase Reporter Assay. from Article... BioAssay record AID 1797989 submitted by BindingDB: ER-alpha Radioligand Binding Assay and ERE-Luciferase Reporter Assay. from Article 10.1021/jm030086h: https://journals.plos.org/plosone/article?id=10.1371/journal.pone.0043175 Studies of Dynamic Protein-Protein Interactions in Bacteria Using Renilla Luciferase... The luciferase protein fragment complementation assay is a powerful tool for studying protein-protein interactions. Two inactive fragments of luciferase are... protein interactionsstudiesdynamicbacteriausing https://pubchem.ncbi.nlm.nih.gov/bioassay/2039162 AID 2039162 - Inhibition of TDG in human HEK293T at 10 uM by Renilla luciferase based reporter... BioAssay record AID 2039162 submitted by ChEMBL: Inhibition of TDG in human HEK293T at 10 uM by Renilla luciferase based reporter assay relative to control. https://pubchem.ncbi.nlm.nih.gov/bioassay/1845220 AID 1845220 - Primary firefly luciferase (FLuc) qHTS assay for identification of artifact... BioAssay record AID 1845220 submitted by National Center for Advancing Translational Sciences (NCATS): Primary firefly luciferase (FLuc) qHTS assay for... https://pubchem.ncbi.nlm.nih.gov/bioassay/624369 AID 624369 - Inhibitors of Epstein-Barr LMP1 inducible NF-kappaB luciferase reporter Measured in... BioAssay record AID 624369 submitted by Broad Institute: Inhibitors of Epstein-Barr LMP1 inducible NF-kappaB luciferase reporter Measured in Cell-Based System... https://www.thermofisher.com/order/catalog/product/100-401-137/faqs Luciferase Polyclonal Antibody - FAQs Find here a list of FAQs for Luciferase Polyclonal Antibody polyclonal antibodyluciferasefaqs https://pubchem.ncbi.nlm.nih.gov/bioassay/1789162 AID 1789162 - Cellular luciferase reporter assay using the SN12C-MEF2-luc cell line and ONE-Glo -... BioAssay record AID 1789162 submitted by ChEMBL: Cellular luciferase reporter assay using the SN12C-MEF2-luc cell line and ONE-Glo. https://experts.umn.edu/en/publications/a-high-throughput-cell-based-gaussia-luciferase-reporter-assay-fo/ A high-throughput cell-based gaussia luciferase reporter assay for identifying modulators of... luciferase reporter assay https://pubchem.ncbi.nlm.nih.gov/bioassay/1749011 AID 1749011 - Agonist activity at rat frizzled-1 expressed in CHO cells by luciferase reporter gene... BioAssay record AID 1749011 submitted by ChEMBL: Agonist activity at rat frizzled-1 expressed in CHO cells by luciferase reporter gene assay. https://umu.diva-portal.org/smash/record.jsf?faces-redirect=true&language=en&searchType=SIMPLE&query=&af=%5B%5D&aq=%5B%5B%5D%5D&aq2=%5B%5B%5D%5D&aqe=%5B%5D&pid=diva2%3A1724082&noOfRows=50&sortOrder=author_sort_asc&sortOrder2=title_sort_asc&onlyFullText=false&sf=all Multiplex functional bioluminescent reporters using gaussia luciferase fused to epitope tags in an... https://pubchem.ncbi.nlm.nih.gov/bioassay/1795022 AID 1795022 - HCV Replicon Assay Luciferase from US Patent US9669095: "Cyclosporin analogues for... BioAssay record AID 1795022 submitted by BindingDB: HCV Replicon Assay Luciferase from US Patent US9669095: https://umu.diva-portal.org/smash/record.jsf?faces-redirect=true&language=en&searchType=SIMPLE&query=&af=%5B%5D&aq=%5B%5B%5D%5D&aq2=%5B%5B%5D%5D&aqe=%5B%5D&pid=diva2%3A636018&noOfRows=50&sortOrder=author_sort_asc&sortOrder2=title_sort_asc&onlyFullText=false&sf=all Transcription Factor Activity Analysis Using a Functional Multiplex Gaussia Luciferase-Based... transcription factoractivityanalysisusing https://pubchem.ncbi.nlm.nih.gov/bioassay/652015 AID 652015 - qHTS Assay for Inhibitors of Sea Pansy Luciferase from the GSK Published Protein... BioAssay record AID 652015 submitted by National Center for Advancing Translational Sciences (NCATS): qHTS Assay for Inhibitors of Sea Pansy Luciferase from... https://lists.wikimedia.org/hyperkitty/list/wikipedia-ne@lists.wikimedia.org/thread/H2FBCOSV7ZOOUO77EOMJFZ6AM6ZIYM3R/ Luciferase Stable Cell Line - Wikipedia-ne - lists.wikimedia.org stable cell lineluciferasewikipedialistswikimedia https://pubchem.ncbi.nlm.nih.gov/bioassay/624501 AID 624501 - qHTS Assay for Rab9 Promoter Activators: Hit Validation Using Firefly Luciferase... BioAssay record AID 624501 submitted by National Center for Advancing Translational Sciences (NCATS): qHTS Assay for Rab9 Promoter Activators: Hit Validation... https://umu.diva-portal.org/smash/record.jsf?faces-redirect=true&language=no&searchType=SIMPLE&query=&af=%5B%5D&aq=%5B%5B%5D%5D&aq2=%5B%5B%5D%5D&aqe=%5B%5D&pid=diva2%3A636018&noOfRows=50&sortOrder=author_sort_asc&sortOrder2=title_sort_asc&onlyFullText=false&sf=all Transcription Factor Activity Analysis Using a Functional Multiplex Gaussia Luciferase-Based... transcription factoractivityanalysisusing https://ub01.uni-tuebingen.de/xmlui/handle/10900/106005 A NanoLuc luciferase-based assay enabling the real-time analysis of protein secretion and injection... https://pubchem.ncbi.nlm.nih.gov/bioassay/624030 AID 624030 - Biochemical firefly luciferase enzyme assay for NPC - PubChem BioAssay record AID 624030 submitted by National Center for Advancing Translational Sciences (NCATS): Biochemical firefly luciferase enzyme assay for NPC. enzyme assayaidbiochemicalfireflyluciferase https://www.wikidata.org/wiki/Q43557905 The in vivo pattern of firefly luciferase expression in transgenic plants. - Wikidata in vivopattern