Robuta

https://www.cellosaurus.org/ Cellosaurus - Cell line encyclopedia Cellosaurus, a cell line database, cell line catalogue, cell line ontology cell linecellosaurusencyclopedia https://pubmed.ncbi.nlm.nih.gov/23287060/ Development of a stable insect cell line constitutively expressing rotavirus VP2 An insect High-Five cell line was generated constitutively and stably expressing the VP2 protein of rotavirus RF strain leading to the formation of core-like... of ainsect celldevelopmentstable https://a549.com/ A549 Cell Line Transfection Protocol Mar 18, 2023 - The A549 cell line is a widely used human lung adenocarcinoma cell line that was derived from a primary lung tumor. A549 cells are highly proliferative and... cell linetransfectionprotocol https://cir.nii.ac.jp/crid/1571417125661760000?lang=ja Establishment of an osteocyte-like cell line, MLO-Y4 | CiNii Research cell lineestablishmentosteocytelike https://www.researchandmarkets.com/reports/5240731/cell-line-characterization-and-cell-line Cell Line Characterization and Cell Line Development Market: Industry Trends and Global Forecasts,... Cell Line Characterization and Cell Line Development Market: Industry Trends and Global Forecasts, Till 2035 - Distribution by Source of Cell Line / Expression... cell line characterizationmarket industrytrends globaldevelopmentforecasts https://www.biointron.com/ Biointron - Antibody Discovery, Antibody Production, Stable cell line, Protein Expression, CRO Biointron is committed to providing high quality and economic recombinant protein/antibody reagents and to be most reliable CRO vendor for life science... stable cell lineantibody discoveryprotein expressionproductioncro https://www.thermofisher.com/blog/biobanking/glioblastoma-cell-line-biobank-a-new-resource/ Glioblastoma Cell Line Biobank: A New Resource Apr 21, 2016 - Xie et al. aim to make the glioblastoma cell line biobank an open-source repository to seed further investigation into glioblastoma and improve future... cell linea newglioblastomabiobankresource https://discover.nci.nih.gov/cellminer/celllineMetadata.do;jsessionid=2559EAC9CFC68E79909CF596B1808EE7 CellMiner - Cell Line Metadata | Genomics and Pharmacology Facility cell linemetadatagenomicspharmacologyfacility https://icbo2016.cgrb.oregonstate.edu/bibcite/reference/24 IP07: The Cell Line Ontology integration and analysis of the knowledge of LINCS cell lines |... the cell https://id.wiktionary.org/wiki/hybridoma_cell_line hybridoma cell line - Wikikamus bahasa Indonesia cell linehybridomawikikamusbahasaindonesia https://pubmed.ncbi.nlm.nih.gov/3026121/?dopt=Abstract Establishment of a continuous cell line derived from leukaemic cattle Establishment of a continuous cell line derived from leukaemic cattle of acell lineestablishmentcontinuousderived https://scholars.lib.ntu.edu.tw/entities/project/0b429f11-8786-4b03-97d4-7ae0d4d7c5f2 Integrative Pharmacogenomic Study via NCI-60 Cell Line-Based Computational System cell lineintegrativepharmacogenomicstudyvia https://proposals.epi.bristol.ac.uk/?q=node/126858 B622 - Large scale lymphoblastoid cell line approaches from genetical genomics to systematic... large scalecell line https://pubchem.ncbi.nlm.nih.gov/bioassay/1792151 AID 1792151 - Caco-2 cell line Proliferation assay - PubChem BioAssay record AID 1792151 submitted by ChEMBL: Caco-2 cell line Proliferation assay. cell lineaidcacoproliferationassay https://pubchem.ncbi.nlm.nih.gov/patent/EP-0305960-A3 A transformant cell line capable of producing a human monoclonal antibody, hybridoma, their... EP-0305960-A3 chemical patent summary. cell line https://www.semanticscholar.org/topic/Recombinant-Glial-Cell-Line-Derived-Neurotrophic/203589 Recombinant Glial Cell-Line Derived Neurotrophic Factor | Semantic Scholar A recombinant therapeutic agent which is chemically identical to or similar to endogenous glial cell line-derived neurotrophic factor (GDNF). GDNF is a... cell linerecombinantglialderivedfactor https://pubmed.ncbi.nlm.nih.gov/9459120/?ordinalpos=60&itool=EntrezSystem2.PEntrez.Pubmed.Pubmed_ResultsPanel.Pubmed_RVDocSum Establishment of a new murine-phenotypic angiosarcoma cell line (ISOS-1) A cell line, designated ISOS-1, was established from a tumor formed by transplantation of a human angiosarcoma into mice with severe combined immunodeficiency... of acell lineestablishmentnewmurine https://ascentgene.com/ AscentGene | High-quality cell line and protein services high qualitycell lineproteinservices https://pubchem.ncbi.nlm.nih.gov/bioassay/1788531 AID 1788531 - MDA_MB_468 cell line Proliferation assay - PubChem BioAssay record AID 1788531 submitted by ChEMBL: MDA_MB_468 cell line Proliferation assay. cell lineaidmdambproliferation https://pubmed.ncbi.nlm.nih.gov/12746475/?dopt=Abstract Apoptotic body engulfment by a human stellate cell line is profibrogenic Hepatocyte apoptosis and stellate cell activation are both features of chronic liver diseases, but a relationship between these events has not been explored.... by a humancell linebody https://jglobal.jst.go.jp/en/detail?JGLOBAL_ID=202010011986415443 Cell Line Integrated Molecular Authentication Database: CLIMA | Research Resource Information |... Research Resource "Cell Line Integrated Molecular Authentication Database: CLIMA" Detailed information of the J-GLOBAL is an information service managed by the... cell lineresearch resourceintegratedmolecularauthentication https://publica.fraunhofer.de/entities/publication/92bc1831-43f0-49e8-8cd5-c811274747b7 New cell line from adipopancreatic tissue of Atlantic herring Clupea harengus We report the isolation, cultivation, and cryopreservation of cells from adipopancreatic tissue of adult Atlantic herring Clupea harengus. The cell population... new cellatlantic herringline https://pubmed.ncbi.nlm.nih.gov/15212950/ Overexpression of glial cell line-derived neurotrophic factor induces genes regulating migration... The glial cell line-derived neurotrophic factor (GDNF) is involved in the development and maintenance of neural tissues. Mutations in components of its... cell line https://pubmed.ncbi.nlm.nih.gov/10188735/ Establishment of a human hemangiosarcoma cell line (ISO-HAS) A cell line (ISO-HAS) has been established from tumor tissue of a human hemangiosarcoma arising on the scalp by the use of conditioned medium from a... of acell lineestablishmenthumanhemangiosarcoma https://www.crig.ugent.be/en/tags/cell-line Cell line | CRIG cell line https://pubchem.ncbi.nlm.nih.gov/bioassay/1792147 AID 1792147 - LS174T cell line Proliferation assay - PubChem BioAssay record AID 1792147 submitted by ChEMBL: LS174T cell line Proliferation assay. cell lineaidproliferationassaypubchem https://experts.colorado.edu/display/meshid_A11.251.210.190.380 Cell Line - HCT116 Cells | CU Experts | CU Boulder cell linecellscuexpertsboulder https://pubchem.ncbi.nlm.nih.gov/bioassay/1788485 AID 1788485 - H23 cell line Proliferation assay - PubChem BioAssay record AID 1788485 submitted by ChEMBL: H23 cell line Proliferation assay. cell lineaidproliferationassaypubchem https://pubmed.ncbi.nlm.nih.gov/1460674/ Karyotypic derivation of H9 cell line expressing human immunodeficiency virus susceptibility These data should be useful for studying specific chromosome changes linking the expression of the HIV susceptibility unique to H9 cells. Karyologic studies... human immunodeficiency viruscell linederivation https://docs.thermofisher.com/r/BioPharma-Finder-5.2-Intact-Mass-Analysis-User-Guide/1201386507v1 N-linked glycans with a CHO host cell-line type - N-linked glycans with a CHO host cell-line type -... The following table lists the N-linked glycans, sorted by CHO host cell-line type, that are included in the N-glycan-specific search. In the table header,... with ahost cellnchotype https://pubchem.ncbi.nlm.nih.gov/bioassay/104063 AID 104063 - Cytotoxicity in MCF-7 cancer cell line - PubChem BioAssay record AID 104063 submitted by ChEMBL: Cytotoxicity in MCF-7 cancer cell line. cancer cellaidcytotoxicitymcfline https://www.discover.nci.nih.gov/cellminer/celllineMetadata.do;jsessionid=75B659A7A9ACAC7BDA56F3A6929FEBF8 CellMiner - Cell Line Metadata | Genomics and Pharmacology Facility cell linemetadatagenomicspharmacologyfacility https://experts.arizona.edu/en/publications/characterizing-a549-cell-line-as-an-epithelial-cell-monolayer-mod/ Characterizing A549 Cell Line as an Epithelial Cell Monolayer Model for Pharmacokinetic... cell linecharacterizing https://www.prnewswire.com/news-releases/atcc-launches-mouse-cell-line-authentication-service-300931087.html ATCC Launches Mouse Cell Line Authentication Service /PRNewswire/ -- ATCC today announced the launch of a new authentication service that will allow researchers to easily confirm the identity of mouse cell... cell line authenticationatcclaunchesmouseservice https://tp53.cancer.gov/search_cell_lines TP53 Database: Search Cell-Line Data The TP53 Database: knowledgebase and statistical tools for the analysis of TP53 gene variants in human cancers database searchcell line https://pubchem.ncbi.nlm.nih.gov/bioassay/1785875 AID 1785875 - Cervic cancer cell line Proliferation assay - PubChem BioAssay record AID 1785875 submitted by ChEMBL: Cervic cancer cell line Proliferation assay. cancer cellaidlineproliferationassay https://pubchem.ncbi.nlm.nih.gov/bioassay/1792924 AID 1792924 - OPM-2 cell line Proliferation assay - PubChem BioAssay record AID 1792924 submitted by ChEMBL: OPM-2 cell line Proliferation assay. cell lineaidopmproliferationassay https://pubchem.ncbi.nlm.nih.gov/bioassay/1789823 AID 1789823 - Lung A549 cell line MDS Pharma Services Proliferation Assay - PubChem BioAssay record AID 1789823 submitted by ChEMBL: Lung A549 cell line MDS Pharma Services Proliferation Assay. cell line https://www.news-medical.net/whitepaper/20230316/How-to-overcome-the-biggest-challenges-in-Cell-Line-development.aspx How to overcome the biggest challenges in cell line development Oct 25, 2025 - While cell line development technologies continue to improve, there are still numerous hurdles to overcome. This article discusses the biggest challenges in... how tothe biggestcell lineovercomechallenges https://scholars.uky.edu/es/publications/glial-cell-line-derived-neurotrophic-factor-augments-midbrain-dop/ Glial cell line-derived neurotrophic factor augments midbrain dopaminergic circuits in vivo - cell line https://lists.wikimedia.org/hyperkitty/list/wikipedia-ne@lists.wikimedia.org/thread/H2FBCOSV7ZOOUO77EOMJFZ6AM6ZIYM3R/ Luciferase Stable Cell Line - Wikipedia-ne - lists.wikimedia.org stable cell lineluciferasewikipedialistswikimedia https://rosenberglab.stanford.edu/diversity.html Rosenberg lab - HGDP-CEPH human genome diversity cell line panel human genomecell linerosenberglabceph https://www.news-medical.net/industry-focus/Optimizing-cell-line-development-for-recombinant-proteins-and-monoclonal-antibodies Optimizing cell line development for recombinant proteins and monoclonal antibodies | eBook Learn how to streamline your cell line development process for recombinant protein and monoclonal antibody production with this comprehensive eBook. cell line developmentrecombinant proteinsmonoclonal antibodiesoptimizing https://vivo.colorado.edu/display/meshid_A11.251.210.100.550 Cell Line - NIH 3T3 Cells | CU Experts | CU Boulder cell linenihcellscuexperts https://web.cdn.cyagen.com/ Knockout Mouse, Rat, Cell Line Model Generation | Cyagen Cyagen specializes in generating knockout/transgenic mice, rats and cell line models, as well as virus packaging, vector cloning, stem cells and cell culture... mouse ratcell linemodel generationknockoutcyagen https://pubchem.ncbi.nlm.nih.gov/bioassay/1788594 AID 1788594 - Kasumi-1 cell line Proliferation assay - PubChem BioAssay record AID 1788594 submitted by ChEMBL: Kasumi-1 cell line Proliferation assay. cell lineaidkasumiproliferationassay https://www.med.unc.edu/vironomics/sequencing-1/str-cell-line-authentication STR Cell Line Authentication | Vironomics Core cell line authenticationstrcore https://pubchem.ncbi.nlm.nih.gov/bioassay/1963003 AID 1963003 - KMS-12-PE cell line Proliferation assay - PubChem BioAssay record AID 1963003 submitted by ChEMBL: KMS-12-PE cell line Proliferation assay. cell lineaidkmspeproliferation https://pubchem.ncbi.nlm.nih.gov/cell/CHEMBL3307820 Melanoma cell line | Cell - PubChem Cell information for Melanoma cell line. Find diseases associated with this biological target and compounds tested against it in bioassay experiments. cell linemelanomapubchem https://pubchem.ncbi.nlm.nih.gov/compound/Hela-cell-line Hela cell line - PubChem Hela cell line chemical information summary. cell linehelapubchem https://www.news-medical.net/ACROBiosystems-HEK293Human-TL1A-Stable-Cell-Line HEK293/Human TL1A Stable Cell Line : Get Quote, RFQ, Price or Buy The HEK293/human TL1A stable cell line expresses full-length human TL1A (UniProt O95150-1). stable cell line https://pubmed.ncbi.nlm.nih.gov/40362347/ Secretory Profile Analysis of Human Granulosa Cell Line Following Gonadotropin Stimulation Granulosa cell (GC) differentiation, stimulated by FSH and LH, drives oocyte maturation and follicle development. FSH promotes GC proliferation, and LH... profile analysiscell linehuman https://pubmed.ncbi.nlm.nih.gov/3858609/ A new leukemia cell line with Philadelphia chromosome characterized as basophil precursors A new myeloid cell line (KU812) was established from a patient with blastic crisis of chronic myelogenous leukemia. His blasts were morphologically... a newcell line https://www.nist.gov/publications/standards-cell-line-authentication-and-beyond Standards for cell line authentication and beyond | NIST Oct 12, 2021 - Different genomic technologies have been applied to cell line authentication, but only one method (short tandem repeat profiling) has been the subject of a comp cell line authenticationand beyondstandardsnist https://www.fda.gov/science-research/licensing-and-collaboration-opportunities/stable-cell-line-validating-next-generation-sequencing-ngs-methods-detecting-adventitious-viruses Stable cell line for validating next-generation sequencing (NGS) methods for detecting adventitious... Stable cell line for validating next-generation sequencing (NGS) methods for detecting adventitious viruses contaminating biological products stable cell linenext generation sequencing https://scholars.lib.ntu.edu.tw/entities/project/d157314e-222d-4b24-bb88-f6ad4e917ae4 Establishment of Human Embryonic Stem Cell Line, Its Maintenance and Germ Cell Lineage... stem cell https://infoscience.epfl.ch/entities/publication/4830f983-4e67-43ef-8a57-68cb335bd4d7?ln=en Glial cell line-derived neurotrophic factor (GDNF), a new neurotrophic factor for motoneurones Glial cell line-derived neurotrophic factor (GDNF) has been postulated to be a specific dopaminergic neurotrophic factor since it selectively enhances the... cell linea newglialderived https://pubchem.ncbi.nlm.nih.gov/patent/US-2003003088-A1 Human pancreatic pluripotential stem cell line - Patent US-2003003088-A1 - PubChem US-2003003088-A1 chemical patent summary. stem cellpatent ushumanpancreatic https://experts.colorado.edu/display/meshid_A11.251.210.172 Cell Line, Transformed | CU Experts | CU Boulder cell linetransformedcuexpertsboulder https://pubchem.ncbi.nlm.nih.gov/bioassay/1788538 AID 1788538 - HCC1143 cell line Proliferation assay - PubChem BioAssay record AID 1788538 submitted by ChEMBL: HCC1143 cell line Proliferation assay. cell lineaidproliferationassaypubchem https://www.news-medical.net/whitepaper/20240605/Reaching-98425-probability-of-clonality-for-robust-cell-line-development.aspx Reaching 98.4% probability of clonality for robust cell line development Mar 6, 2026 - This article explores how an exceptionally high probability of clonality can be achieved for robust cell line development. cell linereachingprobability https://pubchem.ncbi.nlm.nih.gov/bioassay/45892 AID 45892 - In vitro cytotoxicity in CEM-SS cell line up to a concentration of 100 uM. - PubChem BioAssay record AID 45892 submitted by ChEMBL: In vitro cytotoxicity in CEM-SS cell line up to a concentration of 100 uM.. https://nrc-publications.canada.ca/fra/voir/objet/?id=557cb419-413f-4b4d-b9e8-3a111e9ee25a Calcium-activated potassium channels in the UCR-SE-la lepidopteran cell line from the beet armyworm... Calcium-activated potassium channels in the UCR-SE-la lepidopteran cell line from the beet armyworm (Spodoptera Exigua) https://pubmed.ncbi.nlm.nih.gov/40870991/ Insights into the Structural Patterns in Human Glioblastoma Cell Line SF268 Activity and ADMET... https://pubchem.ncbi.nlm.nih.gov/bioassay/99245 AID 99245 - Effective dose to show cytotoxicity against leukemia MOLT-4 cell line was determined -... BioAssay record AID 99245 submitted by ChEMBL: Effective dose to show cytotoxicity against leukemia MOLT-4 cell line was determined. https://experts.illinois.edu/en/publications/characterization-of-a-porcine-intestinal-epithelial-cell-line-for/ Characterization of a porcine intestinal epithelial cell line for influenza virus production -... of a https://pubchem.ncbi.nlm.nih.gov/bioassay/45182 AID 45182 - Tested for cytotoxicity against human CEM-SS cell line; Percent reduction 40 - PubChem BioAssay record AID 45182 submitted by ChEMBL: Tested for cytotoxicity against human CEM-SS cell line; Percent reduction 40. https://pubmed.ncbi.nlm.nih.gov/18618314/ The effects of Fructus Xanthii extract on cytokine release from human mast cell line (HMC-1) and... In the present study, human mast cell line (HMC-1) and peripheral blood mononuclear cells (PBMNC) were pre-incubated with various concentrations of Fructus... https://www.iac.cnr.it/index.php/modeling-atp-mediated-endothelial-cell-elongation-line-patterns-0 Modeling ATP-mediated endothelial cell elongation on line patterns | IAC on linemodelingatpmediatedendothelial https://edrn.cancer.gov/data-and-resources/publications/17401460-927-molecular-characterization-of-tmprss2-erg-gene-fusion-in-the-nci-h660-prostate-cancer-cell-line-a-new-perspective-for-an-old-model/ Molecular characterization of TMPRSS2-ERG gene fusion in the NCI-H660 prostate cancer cell line: a... This is a publication by a member of the Early Detection Research Network. https://pubmed.ncbi.nlm.nih.gov/14584035/ Mechanisms of internalization of apoptotic and necrotic L929 cells by a macrophage cell line... Rapid and efficient phagocytic removal of dying cells is a key feature of apoptosis. In necrotic caspase-independent modes of death, the role and extent of... https://pubchem.ncbi.nlm.nih.gov/bioassay/43536 AID 43536 - In vitro anticancer activity against CCRF-CEM leukemia cell line; not available -... BioAssay record AID 43536 submitted by ChEMBL: In vitro anticancer activity against CCRF-CEM leukemia cell line; not available. https://livingstingy.blogspot.com/2011/04/using-cell-phone-as-land-line.html?m=0 Living Stingy: Using a Cell Phone as a Land Line A simple docking station, such as this dock-and-talk, usually available for under $100 online, can connect your cellphone to your landl... cell phonelivingstingyusingland https://page.line.me/817qqzsc CELL GRAND CLINIC | LINE Official Account CELL GRAND CLINIC's LINE official account profile page. Add them as a friend for the latest news. line officialcellgrandclinicaccount https://www.verizon.com/business/answers/best-2-line-unlimited-cell-phone-plans/ Best 2 Line Unlimited Cell Phone Plans | Verizon Business Find the best 2-line unlimited cell phone plans at Verizon Business. Enjoy top-notch coverage and savings. Explore plans today! cell phone plansbestlineunlimitedverizon https://huh7.com/ Huh-7 Origin - HUH-7 Cell Line Feb 27, 2023 - The HuH-7 cell line was established in 1982 from a well differentiated hepatocyte derived cellular carcinoma cell line that was originally huhorigincellline https://scholarworks.indianapolis.iu.edu/items/428d2a1d-ba6d-4cbc-9c93-3fc7cd531b8d The SK-N-AS human neuroblastoma cell line develops osteolytic bone metastases with increased... Neuroblastoma (NB), which arises from embryonic neural crest cells, is the most common extra-cranial solid tumor of childhood. Approximately half of NB... https://www.thermofisher.com/antibody/primary/panther/female%20germ-line%20stem%20cell%20population%20maintenance female germ-line stem cell population maintenance Antibodies | Invitrogen Antibodies for proteins involved in female germ-line stem cell population maintenance pathways, according to their Panther/Gene Ontology Classification stem cellfemalegermlinepopulation https://research-portal.uu.nl/en/publications/fluorescence-based-transport-assays-revisited-in-a-human-renal-pr/fingerprints/ Fluorescence-Based Transport Assays Revisited in a Human Renal Proximal Tubule Cell Line -... https://tobias-lib.uni-tuebingen.de/xmlui/handle/10900/145106 Generation of an induced pluripotent stem cell (iPSC) line from a patient with GEFS plus carrying a... https://portal.fis.leibniz-lsb.tum.de/en/activities/il-6-release-by-a-human-gingival-fibroblast-cell-line-correlates-/ IL-6 Release by a Human Gingival Fibroblast Cell Line Correlates with the Bitter Taste Threshold of... https://pubmed.ncbi.nlm.nih.gov/37142267/ Comparison of first-line radiosurgery for small-cell and non-small cell lung cancer brain... After SRS, SCLC histology was associated with shorter OS compared to NSCLC. CNS progression occurred earlier in SCLC patients overall but was similar in... https://pubmed.ncbi.nlm.nih.gov/27932067/ Nivolumab plus ipilimumab as first-line treatment for advanced non-small-cell lung cancer... Bristol-Myers Squibb. https://pubmed.ncbi.nlm.nih.gov/26330055/ ATGL and CGI-58 are lipid droplet proteins of the hepatic stellate cell line HSC-T6 Lipid droplets (LDs) of hepatic stellate cells (HSCs) contain large amounts of vitamin A [in the form of retinyl esters (REs)] as well as other neutral lipids... https://eprints.ncl.ac.uk/256995 A novel CRISPR-engineered prostate cancer cell line defines the AR-V transcriptome and identifies... https://www.ncbi.nlm.nih.gov/nuccore/AK147611 Mus musculus adult male brain UNDEFINED_CELL_LINE cDNA, RIKEN full-len - Nucleotide - NCBI https://pubmed.ncbi.nlm.nih.gov/6268887/ Isolation of feline leukemia virus from a leopard cat cell line and search for retrovirus in wild... A strain of feline leukemia virus (FeLV), subgroup A, was isolated in early subpassage of a testicular fibroblast culture obtained from a captive Asian leopard... https://www.cdc.gov/brfss/acbs/2019_tables_llcp.html CDC - BRFSS - ACBS - 2019 BRFSS Asthma Call-back Survey Land Line And Cell Phone Combined Adult... BRFSS has a long history in behavioral and chronic disease surveillance. Fifteen states participated in the first BRFSS, conducted in 1984. https://pubmed.ncbi.nlm.nih.gov/26425143/ Clinical experience with everolimus in the second-line treatment of advanced renal cell carcinoma Everolimus is an oral inhibitor of mammalian target of rapamycin (mTOR-I) and is currently approved for the treatment of metastatic renal cell carcinoma (mRCC)... https://pubmed.ncbi.nlm.nih.gov/32045731/ Generation of a human induced pluripotent stem cell line (SDUBMSi001-A) from a hereditary spastic... KIF1A gene encodes the kinesin 1a protein, an axonal motor protein participating in axonal transport. Variants in KIF1A were identified in different forms of...