Robuta

https://repository.up.ac.za/items/339c2afc-0668-408d-b644-7be513d69b8f Improved method for the generation and selection of homogeneous lumpy skin disease virus... Please refer to abstract in article lumpy skin diseasefor theimprovedmethodgeneration https://www.ndtv.com/india-news/1-5-crore-cows-vaccinated-in-up-in-2-months-against-lumpy-skin-disease-3464540 1.5 Crore Cows Vaccinated In UP In 2 Months Against Lumpy Skin Disease Uttar Pradesh has vaccinated a record 1.50 crore cows and other cattle against the lumpy skin disease in the last two months, the state government said on... lumpy skin diseasecrorecowsvaccinatedmonths https://jurnal.pustakagalerimandiri.co.id/index.php/pustakaai/article/view/1874 Implementasi CNN Model Resnet50 Klasifikasi Citra Penyakit Lumpy Skin Disease Pada Sapi | Jurnal... lumpy skin diseasecnnmodelcitrapenyakit https://www.burdekinlife.com/article/secured-vaccines-strengthen-australias-defence-against-lumpy-skin-disease-threat Secured Vaccines Strengthen Australia's Defence Against Lumpy Skin Disease Threat - Mackay... 300,000 doses of a vaccine against the serious cattle virus that causes lumpy skin disease (LSD) have been secured in an agreement that will help Australia... lumpy skin diseasesecuredvaccinesstrengthenaustralia https://www.fao.org/europe/events/detail/Second-regional-workshop-on-lumpy-skin-disease-(LSD)-prevention-control-and-awareness-raising/en Second regional workshop on lumpy skin disease (LSD) prevention, control, and awareness raising With the progressive transboundary spread of LSD, a harmonized regional approach to control the disease in the region is highly recommended. This second regi... lumpy skin diseaseawareness raisingsecondregionalworkshop https://openlibrarypublications.telkomuniversity.ac.id/index.php/engineering/article/view/26473/25095 View of Rancang Bangun Aplikasi Pendeteksi Penyakit Lumpy Skin Disease Pada Sapi Berbasis Android... lumpy skin diseaseviewaplikasipenyakitsapi https://crv4all.nl/nl/news/crv-volgt-uitbraken-lumpy-skin-disease-op-de-voet CRV volgt uitbraken lumpy skin disease op de voet - CRV Jul 17, 2025 - CRV volgt uitbraken lumpy skin disease op de voet lumpy skin diseasecrvopdevoet https://www.indiatodayne.in/sikkim/story/sikkim-achieves-milestone-with-pcr-based-diagnosis-of-lumpy-skin-disease-african-swine-fever-1247509-2025-07-20 Sikkim achieves milestone with PCR-based diagnosis of lumpy skin disease, African swine fever -... Jul 20, 2025 - Sikkim's SADDL has pioneered PCR testing for Lumpy Skin Disease and African Swine Fever, enhancing early detection of these livestock threats. This move aims... lumpy skin diseaseafrican swine feversikkimmilestonepcr https://www.emergence-msd-animal-health.com/event/lumpy-skin-disease-pilot-virtual-learning-course/ Lumpy Skin Disease Pilot Virtual Learning Course - emergence-msd-animal-health-com Jun 20, 2023 - Organised by FAO and EuFMD this is a pilot of the Lumpy Skin Disease Preparedness virtual learning course. This is an online tutored course that aims to... lumpy skin diseasemsd animal healthvirtual learningpilotcourse https://foodmarket.com/News/A/1311778/0/Statement-on-Recent-Lumpy-Skin-Disease-Outbreaks-in-Europe Statement on Recent Lumpy Skin Disease Outbreaks in Europe The World Organisation for Animal Health (WOAH) acknowledges the rapid official notifications of two outbreaks of Lumpy skin disease (LSD) in Italy and France,... lumpy skin diseasestatementrecentoutbreakseurope https://www.iiste.org/Journals/index.php/DCS/article/view/23110 Study on the Epidemiological and Financial Impacts of Clinical Lumpy Skin Disease in Selected... Study on the Epidemiological and Financial Impacts of Clinical Lumpy Skin Disease in Selected Districts of Tigray and Afar Regional States, North Eastern... lumpy skin diseaseon thefinancial impactsstudyclinical https://www.uniceb.it/dermatite-nodulare-contagiosa-bovina-lumpy-skin-disease-terzo-caso-confermato-in-sardegna/ Dermatite Nodulare Contagiosa Bovina (Lumpy Skin Disease) - Uniceb Mar 23, 2026 - Dermatite Nodulare Contagiosa Bovina (Lumpy Skin Disease) - Terzo caso confermato in Sardegna. lumpy skin diseasedermatitebovinauniceb https://indianjournals.com/article/jar-15-1-007 Inactivation of Lumpy Skin Disease Virus Isolate Obtained from the Field Outbreaks using Binary... Inactivation of Lumpy Skin Disease Virus Isolate Obtained from the Field Outbreaks using Binary Ethylenimine lumpy skin diseasefrom the fieldvirusisolateobtained https://krishijagran.com/animal-husbandry/livestock-farmers-alert-lumpy-skin-disease-spreads-to-20-districts-of-gujarat-killing-over-1400-cattles/ Livestock Farmers Alert! Lumpy Skin Disease Spreads to 20 Districts of Gujarat Killing Over 1400... The government on July 26 issued an official notification to impose restrictions on the transportation of cattle and holding of cattle fairs in the 14 affected... lumpy skin diseaselivestockfarmersalertspreads https://aawaajnews.com/tag/lumpy-skin-disease-nepal/ lumpy skin disease nepal Archives | AawaajNews lumpy skin diseasenepalarchives https://discovery.researcher.life/article/epidemiological-investigation-of-lumpy-skin-disease-in-jhenaidah-district-of-bangladesh/2d33962393533765a667ac5620bd439e Epidemiological investigation of lumpy skin disease in Jhenaidah district of Bangladesh - R... Article on Epidemiological investigation of lumpy skin disease in Jhenaidah district of Bangladesh, published in Journal of Bioscience and Environment Research... lumpy skin diseaseinvestigationjhenaidahdistrictbangladesh https://www.sciensano.be/nl/biblio/lumpy-skin-disease-virus-genome-sequence-analysis-putative-spatio-temporal-epidemiology-single-gene Lumpy Skin Disease Virus Genome Sequence Analysis: Putative Spatio-Temporal Epidemiology, Single... lumpy skin diseasesequence analysisvirusgenometemporal https://roshankashmir.net/2022/09/19/lumpy-skin-disease-in-cattle-not-transmittable-to-humans-says-top-official/ Lumpy skin disease in cattle not transmittable to humans, says top official - Roshan Kashmir Sep 19, 2022 - Srinagar, Sep 19: Over 2000 cases of lumpy disease have been reported in Kashmir so far and over 60 percent of the affected animals have recovered. lumpy skin diseasecattlehumanssaystop https://thekashmirwalla.com/lumpy-skin-disease-100-cattle-die-1500-infected-in-north-kashmir/ Lumpy Skin Disease: 100 cattle die, 1,500 infected in north Kashmir Oct 8, 2022 - Lumpy Skin Disease (LSD) is rapidly affecting north Kashmir's Kupwara with more than 1500 infected in the district. lumpy skin diseasecattledieinfectednorth https://sbg.lko.at/fragen-und-antworten-zur-lumpy-skin-disease+2400+4285378?env=bW9kZT1wcmV2JnBhZ2luZz15ZXNfMTAwXzExMCZjdD0xMTAmYmFjaz0x Fragen und Antworten zur Lumpy Skin Disease | Landwirtschaftskammer Salzburg Wichtige Informationen kompakt aufbereitet. fragen und antwortenlumpy skin diseasezurlandwirtschaftskammersalzburg https://onehealthinitiative.com/promed/lumpy-skin-disease-bovine-israel-02-hazafon-oie/ LUMPY SKIN DISEASE, BOVINE - ISRAEL (02): (HAZAFON) OIE - One Health Initiative The One Health Initiative is a movement to forge co-equal, all inclusive collaborations between physicians, osteopathic physicians, veterinarians, dentists,... lumpy skin diseaseone health initiativebovineisraeloie https://www.scielo.org.za/scielo.php?script=sci_abstract&pid=S1019-91282014000100021&lng=en&nrm=iso&tlng=en Seroprevalence of Rift Valley fever and lumpy skin disease in African buffalo (Syncerus caffer) in... rift valley feverlumpy skin diseaseafrican buffalosyncerus caffer https://pure.jbnu.ac.kr/en/publications/genome-wide-characterization-of-lumpy-skin-disease-virus-isolate--2/ Genome-wide characterization of lumpy skin disease virus isolate from Bangladesh - JBNU Researchers... lumpy skin diseasegenomewidecharacterizationvirus https://openveterinaryjournal.com/?mno=227712 Lumpy skin disease: A growing threat to the global livestock industry | Open Veterinary Journal lumpy skin diseaseto thelivestock industrygrowingthreat https://researchexperts.utmb.edu/en/publications/the-interlaboratory-testing-of-the-test-system-for-detection-of-t-2/ The interlaboratory testing of the test-system for detection of the Lumpy skin disease virus DNA... lumpy skin diseasetest systemtestingdetectionvirus https://www.unionesarda.it/en/sardinia/bovine-dermatitis-outbreaks-rise-to-three-now-the-disease-is-once-again-a-fearsome-threat-n49wb1qv Lumpy skin disease in cattle: three outbreaks in Sardinia Apr 17, 2026 - Two Muravera to one in Villaputzu: alarm bells ringing lumpy skin diseasecattlethreeoutbreakssardinia https://www.newindianexpress.com/nation/2022/aug/05/gujarat-mp-in-lumpy-skin-disease-grip-milk-production-takes-a-hit-2484682.html Gujarat, MP in Lumpy Skin Disease grip; milk production takes a hit This account for 5 to 10 per cent of the daily milk procurement, dairy unions in Saurashtra-Kutch have reported a 15 to 20 per cent reduction in daily milk... lumpy skin diseasemilk productiongujaratgriptakes https://www.ordinevetcremona.it/notizie-dall-ordine/archivio-notizie-flash/389-lumpy-skin-disease-controlli-fino-a-tutto-novembre.html Lumpy Skin Disease: controlli fino a tutto novembre - Ordine dei Veterinari della Provincia di... lumpy skin diseasecontrollifinotuttonovembre https://stikespandeglang.com/lumpy-skin-disease-ancaman-serius-bagi-kesehatan-ternak-sapi/ Lumpy Skin Disease: Ancaman Serius bagi Kesehatan Ternak Sapi Apr 25, 2025 - Lumpy Skin Disease: Ancaman Serius bagi Kesehatan Ternak Sapi, tetapi juga menimbulkan kerugian ekonomi yang signifikan lumpy skin diseaseseriuskesehatansapi https://www.naturalremedy.com/tw/things-to-know-about-lumpy-skin-disease-in-cattle/ Lumpy Skin Disease in Cattle: Viral Infection & Management lumpy skin diseaseviral infectioncattlemanagement https://blog.maxthon.com/2025/12/13/52906/ French Lumpy Skin Disease Crisis - Maxthon | Privacy Private Browser Dec 13, 2025 - rench Lumpy Skin Disease Crisis: Case Study and Analysis Executive Summary Since June 2024, France has faced an outbreak of lumpy skin disease (LSD) affecting... lumpy skin diseaseprivate browserfrenchcrisismaxthon https://stikespamekasan.com/dampak-lumpy-skin-disease-terhadap-industri-peternakan/ Dampak Lumpy Skin Disease terhadap Industri Peternakan Apr 25, 2025 - Dampak Lumpy Skin Disease terhadap Industri Peternakan, Dampak ekonomi dan sosial yang ditimbulkan penyakit ini lumpy skin diseasedampakindustripeternakan https://thenewshimachal.com/2022/08/lumpy-skin-disease-50000-animals-vaccinated-in-himachal/ Lumpy Skin Disease: 50,000 animals vaccinated in Himachal Aug 27, 2022 - For the prevention and control of Lumpy Skin Disease, the Animal husbandry department has vaccinated about 50,000 animals in the state. lumpy skin diseaseanimalsvaccinatedhimachal https://tripuratimes.com/ttimesarticle/lumpy-skin-disease-back-again-cases-reported-in-sikkim-subhasish-mitra-wide-angle-132.html Lumpy skin disease back again: Cases reported in Sikkim lumpy skin diseaseback againcasesreportedsikkim https://www.drishtiias.com/daily-updates/daily-news-analysis/lumpy-skin-disease-2 Lumpy Skin Disease Recently, the Punjab State government has airlifted 25 lakh doses of goat pox vaccine to carry out a free vaccination campaign for early prevention of cattle... lumpy skin disease https://boroktimes.com/sikkim-lumpy-skin-disease-detected-among-cattle/ Sikkim: Lumpy skin disease detected among cattle - Borok Times Jun 6, 2023 - The Gangotri region of Sikkim is currently facing a significant challenge in its agricultural sector as contagious lumpy skin disease (LSD) has been detected... lumpy skin diseasesikkimdetectedamongcattle https://radarsemarang.com/tag/lumpy-skin-disease-virus/ Lumpy Skin Disease Virus | RADAR SEMARANG DIGITAL lumpy skin diseasevirusradarsemarangdigital https://www.woah.org/en/document/faq-on-lumpy-skin-disease-lsd/ FAQ on Lumpy Skin Disease (LSD) - WOAH - World Organisation for Animal Health lumpy skin diseaseanimal healthfaqlsdwoah https://www.bbs.bt/185728/ Lumpy skin disease outbreak confirmed in Guma and Toedwang Gewogs, Punakha - BBSCL May 13, 2023 - In Punakha, an outbreak of lumpy skin disease, a viral disease among cattle, has been confirmed. So far, 11 cases have been reported, one from Guma Gewog and... lumpy skin diseaseoutbreakconfirmedgumapunakha https://ricerca.uniba.it/handle/11586/549500 Molecular epidemiology and phylogenetic insights of lumpy skin disease in cattle from diverse... lumpy skin diseasemolecular epidemiologyphylogeneticinsightscattle https://www.theworldstimes.com/big-bjp-protest-in-jaipur-over-lumpy-skin-disease-rajasthan-is-worst-hit/ Big BJP Protest In Jaipur Over Lumpy Skin Disease. Rajasthan Is Worst-Hit - The Worlds Times Sep 20, 2022 - Principal Priest Ashok Gehlot hasdemanded that the central federal government declare lumpy illness as a nationwide tragedy. The Bharatiya Janata Party today... lumpy skin diseasebigbjpprotestjaipur https://www.newsbytesapp.com/news/india/lumpy-skin-disease-kills-67-000-cattle-across-india/story Lumpy skin disease kills 67,000 cattle across India: Details here The Lumpy skin disease has claimed the lives of as many as 67,000 cattle in eight states, as per the data furnished by the Central government on Monday lumpy skin diseaseacross indiadetails herekillscattle https://www.india.com/uttar-pradesh/lumpy-skin-disease-up-govt-bans-cattle-trade-with-4-states-restricts-movement-of-animals-in-these-districts-5648482/ Lumpy Skin Disease: UP Govt Bans Cattle Trade With 4 States; Restricts Movement of Animals in THESE... Sep 23, 2022 - Uttar Pradesh govt bans cattle trade with 4 neighbouring states, imposes lumpy skin diseasegovtbanscattletrade https://ijnrd.org/viewpaperforall.php?paper=IJNRD2301278 LUMPY SKIN DISEASE: REVIEW OF LITERATURE. | INTERNATIONAL JOURNAL OF NOVEL RESEARCH AND DEVELOPMENT LUMPY SKIN DISEASE: REVIEW OF LITERATURE., INTERNATIONAL JOURNAL OF NOVEL RESEARCH AND DEVELOPMENT, UGC CARE Journal, Low Cost Journal lumpy skin diseasereview of literatureresearch and developmentinternational journalnovel https://www.anses.fr/en/content/lumpy-skin-disease-keeping-close-eye-viral-disease-cattle Lumpy skin disease: keeping a close eye on this viral disease in cattle | Agence nationale de... Lumpy skin disease (LSD) is an emerging viral disease that only affects cattle and is mainly transmitted by biting insects. It was previously confined to... lumpy skin diseaseeye onkeepingcloseviral