Robuta

https://www.godaddy.com/en-uk/help/contact-managed-aws-support-at-godaddy-42715 Contact Managed AWS Support at GoDaddy | VPS Hosting - GoDaddy Help GB Follow these steps to submit a support ticket for Managed Amazon Web Services (AWS) at GoDaddy. managed awsvps hostingsupportgodaddyhelp https://www.dpinfotech.net/ Cloud and IT infrastructure services, Managed aws and azure cloud, Linux Hosting, Windows hosting Managed cloud and hosting services @price of unmanaged services offered by others Having the fully managed services make sense to get the best out of it for... it infrastructure servicesmanaged awsazure linuxcloud https://www.mgt-commerce.com/ Managed AWS Hosting for Magento Stores 2026 Jun 22, 2026 - MGT Commerce: 5,000+ Magento stores hosted on AWS since 2011. 4.9/5 rated. 0.3s load times, 99.99% uptime, free migration. Talk to our experts. managed aws hostingfor magentostores https://www.nublue.co.uk/ Managed AWS Cloud & GPU Hosting | Nublue Fully managed AWS cloud hosting and GPU infrastructure for ambitious organisations. Enterprise-grade performance, without the operational complexity. managed aws cloudgpu hosting https://speedyrails.com/ Home - Speedyrails - Managed AWS Services Dec 1, 2025 - Speedyrails is an AWS Advanced Tier Service Partner. We leverage our extensive AWS knowledge to provide exceptional managed services. managed awsspeedyrailsservices https://interpole.net/ InterPole Cloud – Web Hosting, Email, Managed Services, AWS Consultation Web Hosting, Email, Managed Services, AWS Consultation web hostingmanaged servicesinterpolecloudemail https://aws.amazon.com/eks/ Managed Kubernetes Service - Amazon EKS - AWS Amazon Elastic Kubernetes Service (EKS) is a managed service and certified Kubernetes conformant to run Kubernetes on AWS and on-premises. managed kubernetes serviceamazon eksaws https://ayeluya.com/ a-es - Managed WordPress Hosting Powered by Amazon AWS managed wordpress hostingpowered byamazonaws https://aws.amazon.com/managed-services/ AWS Managed Services AWS Managed Services provides ongoing management of your AWS infrastructure so you can focus on your applications. aws managedservices https://aws.amazon.com/rds/ Fully Managed Relational Database – Amazon RDS – AWS Amazon Relational Database Service (RDS) is a fully managed, open source cloud database service that allows you to easily operate and scale your relational... fully managedrelational databaseamazon rdsaws https://depot.dev/docs/managed/on-aws Depot Managed on AWS | Depot Managed | Depot Documentation Depot Managed allows you to deploy the Depot data plane in your own AWS account. This provides data residency, compliance, and cost control benefits. depot managed on awsdocumentation https://aws.amazon.com/about-aws/whats-new/2025/09/amazon-managed-service-prometheus-11-regions/ Amazon Managed Service for Prometheus now available in 11 additional AWS Regions - AWS Discover more about what's new at AWS with Amazon Managed Service for Prometheus now available in 11 additional AWS Regions managed servicenow available https://aws.amazon.com/blogs/aws/category/application-integration/amazon-managed-workflows-for-apache-airflow-amazon-mwaa/ Amazon Managed Workflows for Apache Airflow (Amazon MWAA) | AWS News Blog apache airflowaws newsamazonmanagedworkflows https://aws.amazon.com/it/about-aws/whats-new/2019/11/introducing-aws-managed-rules-for-aws-waf/ Presentazione di AWS Managed Rules per AWS WAF aws managedpresentazionedirulesper https://aws.amazon.com/marketplace/pp/prodview-kgoif64v2ct3g AWS Marketplace: eCloudvalley SecurityPilot Managed EDR Service eCloudvalley SecurityPilot is a professional Managed Detection and Response (MDR) service. By combining cutting-edge detection technology with an intuitive... aws marketplacemanaged edrservice https://docs.aws.amazon.com/security-ir/latest/userguide/aws-managed-policies.html AWS Managed Policies - AWS Security Incident Response User Guide Learn about AWS managed policies for AWS Security Incident Response and recent changes to those policies. security incident responseaws managedpoliciesuserguide https://aws.amazon.com/blogs/mt/enhancing-observability-with-a-managed-monitoring-solution-for-amazon-eks/ Enhancing observability with a managed monitoring solution for Amazon EKS | AWS Cloud Operations... Aug 4, 2025 - Introduction Keeping a watchful eye on your Kubernetes infrastructure is crucial for ensuring optimal performance, identifying bottlenecks, and troubleshooting... https://aws.amazon.com/marketplace/pp/prodview-bdijvqo73ft2m AWS Marketplace: Managed AWS Direct Connect for regulated markets Available in over 100 locations globally, Continent 8's Cloud Connect service is a specialised solution that provides a direct, private and secure connection... aws marketplacedirect connectmanagedregulatedmarkets https://docs.aws.amazon.com/codebuild/latest/userguide/buildkite-runner.html Self-managed Buildkite runner in AWS CodeBuild - AWS CodeBuild Learn about setting up self-managed Buildkite runner in AWS CodeBuild. self managedbuildkiterunnerawscodebuild https://aws.amazon.com/about-aws/whats-new/2025/08/amazon-managed-service-for-apache-flink-cmk-support/ Amazon Managed Service for Apache Flink now supports Customer Managed Keys (CMK) - AWS Discover more about what's new at AWS with Amazon Managed Service for Apache Flink now supports Customer Managed Keys (CMK) managed serviceapache flink https://aws.amazon.com/marketplace/pp/prodview-xpu4blw6pgynk?sr=0-11&ref_=beagle&applicationId=AWSMPContessahttp:// AWS Marketplace: Managed Keycloak Managed Keycloak is a complete enterprise solution delivered by Solodev that provides setup, custom branding, maintenance, and U.S.-based support for Keycloak... aws marketplacemanagedkeycloak https://aws.amazon.com/marketplace/pp/prodview-lfhcenjy6ywgw AWS Marketplace: Fortinet Managed IPS Rules for AWS Network Firewall Enhance AWS Network Firewall with AI-driven intrusion prevention. Fortinet Managed IPS Rules deliver automated, continuously updated protection from exploits,... aws marketplacefortinetmanagedipsrules https://aws.amazon.com/marketplace/pp/prodview-v6lt3hvxpdoni AWS Marketplace: AWS Managed Services Comprehensive management of your AWS environment to ensure optimal performance, security, and cost-efficiency, allowing you to focus on your core business... aws marketplacemanagedservices https://docs.aws.amazon.com/aws-managed-policy/latest/reference/AWSMarketplaceAmiIngestion.html AWSMarketplaceAmiIngestion - AWS Managed Policy About the AWS managed policy: AWSMarketplaceAmiIngestion aws managedpolicy https://aws.amazon.com/about-aws/whats-new/2023/12/customer-managed-key-support-aws-codecommit/ Announcing Customer Managed Key (CMK) support in AWS CodeCommit - AWS Discover more about what's new at AWS with Announcing Customer Managed Key (CMK) support in AWS CodeCommit customer managed keyannouncingcmksupportaws https://aws.amazon.com/about-aws/whats-new/2024/06/amazon-ecs-aws-fargate-encrypt-ephemeral-storage-customer-managed-kms-keys/ Amazon ECS on AWS Fargate now allows you to encrypt ephemeral storage with customer-managed KMS... Discover more about what's new at AWS with Amazon ECS on AWS Fargate now allows you to encrypt ephemeral storage with customer-managed KMS keys https://aws.amazon.com/marketplace/pp/prodview-6mbnnj3pgwfzo AWS Marketplace: Managed Cloud Operations Eliminate the innovation tax with this automation-first Managed Cloud Operations service. Built to AWS Well-Architected standards, our solution combines AWS... aws marketplacemanaged cloudoperations https://aws.amazon.com/blogs/architecture/audit-your-supply-chain-with-amazon-managed-blockchain/ Audit Your Supply Chain with Amazon Managed Blockchain | AWS Architecture Blog Jun 25, 2021 - For manufacturing companies, visibility into complex supply chain processes is critical to establishing resilient supply chain management. Being able to trace... amazon managed blockchainaws architectureauditsupply https://aws.amazon.com/marketplace/reviews/reviews-list/B081SK32C7?rating=4&sort=NEWEST&filter=ALL&page=2 AWS Marketplace: Fortinet Managed Rules for AWS WAF - Complete OWASP Top 10 Reviews aws marketplacemanaged rules https://aws.amazon.com/marketplace/pp/prodview-xf66bgecponas AWS Marketplace: Elemental Service Managed by IOanyT Innovations Elemental Service managed by IOanyT Innovations offers cloud-based video processing, optimized for high-quality media streaming and tailored for the modern web. aws marketplacemanaged byelementalserviceinnovations https://aws.amazon.com/marketplace/pp/prodview-eiihlwyuorj5q AWS Marketplace: AWS Key Management Service Managed by IOanyT Innovations IOanyT Innovations: Premier AWS Key Management Service on AWS Marketplace. Streamlined cryptographic solutions to protect and control access to your data... key management serviceaws marketplacemanaged byinnovations https://aws.amazon.com/blogs/apn/what-are-managed-services-in-the-hyperscale-cloud/ What are Managed Services in the Hyperscale Cloud? | AWS Partner Network (APN) Blog https://aws.amazon.com/blogs/big-data/how-flutter-uki-optimizes-data-pipelines-with-aws-managed-workflows-for-apache-airflow/ How Flutter UKI optimizes data pipelines with AWS Managed Workflows for Apache Airflow | AWS Big... May 9, 2025 - In this post, we share how Flutter UKI transitioned from a monolithic Amazon Elastic Compute Cloud (Amazon EC2)-based Airflow setup to a scalable and optimized... https://aws.amazon.com/it/about-aws/whats-new/2019/10/aws-managed-services-ams-simplifies-servicenow-integration/ AWS Managed Services (AMS) semplifica l'integrazione ServiceNow aws managed servicesamslintegrazioneservicenow https://repost.aws/knowledge-center/waf-managed-rules-count-to-block?sc_ichannel=ha&sc_ilang=en&sc_isite=repost&sc_iplace=hp&sc_icontent=AAJ2nc18g3RL2cRRIzUniecg&sc_ipos=2 Transition AWS WAF managed rules from Count to Block mode | AWS re:Post Jul 8, 2026 - I want to transition AWS WAF managed rules from Count mode to Block mode, but I don't want to disrupt traffic. aws wafmanaged rules https://docs.aws.amazon.com/it_it/directoryservice/latest/admin-guide/ms_ad_getting_started.html Guida introduttiva a AWS Managed Microsoft AD - AWS Directory Service Scopri i prerequisiti per AWS Managed Microsoft AD e come creare un AWS Managed Microsoft AD Active Directory. guida introduttivaaws managedmicrosoft addirectoryservice https://aws.amazon.com/about-aws/whats-new/2021/05/amazon-cloudwatch-logs-service-limits-can-now-be-managed-with-aws-service-quotas/ Amazon CloudWatch Logs service limits can now be managed with AWS Service Quotas - AWS Discover more about what's new at AWS with Amazon CloudWatch Logs service limits can now be managed with AWS Service Quotas amazon cloudwatch logsservice limits https://aws.amazon.com/marketplace/pp/prodview-jx4xumyu4okgc AWS Marketplace: Managed XDR Managed XDR by Check Point Services (formerly Infinity Global Services) integrates telemetry from Check Point and supported third party sources to deliver... aws marketplacemanagedxdr https://aws.amazon.com/marketplace/pp/prodview-gtewe4whd3qno AWS Marketplace: Managed Snapshot Cleanup Profile and categorize EBS snapshots within your AWS environment, and, once these snapshots are reviewed, perform automated cleanups of older and unused... aws marketplacemanagedsnapshotcleanup https://aws.amazon.com/about-aws/whats-new/2026/04/amazon-managed-grafana-v12-create/ Amazon Managed Grafana now supports creating Grafana 12.4 workspaces - AWS Discover more about what's new at AWS with Amazon Managed Grafana now supports creating Grafana 12.4 workspaces amazon managed grafananow supportscreatingworkspacesaws https://aws.amazon.com/about-aws/whats-new/2022/10/aws-app-runner-support-php-go-dot-net-ruby-managed-runtimes/ AWS App Runner launches support for PHP, Go, .Net, and Ruby managed runtimes - AWS Discover more about what's new at AWS with AWS App Runner launches support for PHP, Go, .Net, and Ruby managed runtimes aws app runner https://www.cloudhesive.com/ CloudHesive | AWS Cloud Solutions and Managed Services Jun 25, 2026 - CloudHesive offers AWS cloud solutions and managed services to empower your business with migrations, cloud security, and innovation. aws cloud solutionsmanagedservices https://docs.aws.amazon.com/aws-managed-policy/latest/reference/AWSThinkboxAWSPortalAdminPolicy.html AWSThinkboxAWSPortalAdminPolicy - AWS Managed Policy About the AWS managed policy: AWSThinkboxAWSPortalAdminPolicy aws managedpolicy https://aws.amazon.com/marketplace/pp/prodview-hb4dxdg3zqpoe AWS Marketplace: Managed Services - Managed Detection and Response The "Manage Detect and Respond Services" provided by Driven Technologies are at the forefront of cybersecurity innovation, utilizing advanced technologies such... aws marketplacemanaged servicesdetectionresponse https://aws.amazon.com/marketplace/pp/prodview-6wqgzwd4cl7fg AWS Marketplace: 24x7 Managed Security Services (Palo Alto Networks, Fortinet) As cybersecurity challenges continue to grow in scale, scope and complexity, it is too important to leave it to chance, instead, leave it to the experts! MSSPs... managed security servicespalo alto networksaws marketplacefortinet https://aws.amazon.com/marketplace/pp/prodview-hffpy7pmvszxe AWS Marketplace: Data Streaming Architecture Service Managed by IOanyT Innovations Data Streaming Architecture refers to the framework and processes designed to efficiently collect, process, and deliver real-time data from various sources to... aws marketplacedata streamingarchitecture servicemanaged byinnovations https://www.sas.com/en_gb/news/press-releases/2024/april/sas-expands-hosted-managed-services-to-aws.html SAS expands hosted managed services to AWS | SAS UK Data and artificial intelligence (AI) leader SAS has officially expanded its SAS-hosted managed services to Amazon Web Services (AWS). managed servicessasexpandshostedaws https://aws.amazon.com/blogs/big-data/create-cross-account-custom-amazon-managed-grafana-dashboards-for-amazon-redshift/ Create cross-account, custom Amazon Managed Grafana dashboards for Amazon Redshift | AWS Big Data... Jun 22, 2022 - Amazon Managed Grafana recently announced a new data source plugin for Amazon Redshift, enabling you to query, visualize, and alert on your Amazon Redshift... amazon managed grafana https://github.com/aws/aws-codebuild-docker-images GitHub - aws/aws-codebuild-docker-images: Official AWS CodeBuild repository for managed Docker... Official AWS CodeBuild repository for managed Docker images http://docs.aws.amazon.com/codebuild/latest/userguide/build-env-ref.html -... aws codebuilddocker imagesofficial repositorygithubmanaged https://aws.amazon.com/about-aws/whats-new/2024/02/amazon-managed-blockchain-query-access-non-finalized-blockchain-data/ Amazon Managed Blockchain Query now provides access to non-finalized blockchain data - AWS Discover more about what's new at AWS with Amazon Managed Blockchain Query now provides access to non-finalized blockchain data amazon managed blockchainquery now https://docs.aws.amazon.com/elasticbeanstalk/latest/dg/using-service-linked-roles-managedupdates.html The managed-updates service-linked role - AWS Elastic Beanstalk How to use service-linked roles to give Elastic Beanstalk access to resources in your AWS account. managed updatesservicelinkedroleaws https://aws.amazon.com/marketplace/pp/prodview-g2hf6dat7dmwu AWS Marketplace: Funded VMware Migration with Managed CloudOps by Opti9 The Funded VMware Migration with Managed CloudOps by Opti9 helps VMware users escape rising costs, limited flexibility, and mounting technical debt by... aws marketplacevmware migrationfundedmanagedcloudops https://aws.amazon.com/marketplace/pp/prodview-4nkqqahmre23e AWS Marketplace: AWS WAF Managed Service by Ness Enhance and Manage Your Web Security with Ness. Our AWS WAF Managed Service provides ongoing robust security for your web applications, ensuring continuous... aws marketplacemanaged servicewafness https://aws.amazon.com/blogs/database/how-coupa-migrated-from-a-self-hosted-redis-to-fully-managed-amazon-elasticache/ How Coupa migrated from a self-hosted Redis to fully managed Amazon ElastiCache | AWS Database Blog Nov 9, 2021 - This is a guest post by Ramesh Sencha, Lead Cloud Engineer at Coupa. Coupa Software (NASDAQ: COUP) is a leader in Business Spend Management (BSM). Coupa... https://aws.amazon.com/marketplace/pp/prodview-oudupa3s53yjc AWS Marketplace: [IN] Redington AWS Managed services-As-Product A standardized, outcome driven managed cloud offering built on Amazon Web Services to ensure secure, reliable, and cost-optimized operations. It delivers 24x7... aws marketplacemanaged servicesredingtonproduct https://aws.amazon.com/marketplace/pp/prodview-x5kqvlye2273u AWS Marketplace: EnCloud Comprehensive Cloud Managed Services A complete managed services solution. EnCloud provides expert cloud governance, operations, security management, and cost optimization to streamline your... aws marketplacecloud managedcomprehensiveservices https://master.cds.hku.hk/service/aws-managed-services/ AWS Managed Services - HKU, School of Computing and Data Science, Taught Master Programmes Nov 18, 2025 - Network Infrastructure and Design Network infrastructure and design are the backbone of modern businesses, serving as the foundation upon which all digital... computing and data scienceaws managed services https://docs.aws.amazon.com/id_id/mwaa/latest/userguide/samples-secrets-manager.html Menggunakan kunci rahasia AWS Secrets Manager untuk koneksi Apache Airflow - Amazon Managed... Contoh panggilan berikut AWS Secrets Manager untuk mendapatkan kunci rahasia untuk koneksi Apache Airflow di Amazon Managed Workflows untuk Apache Airflow. aws secrets manager https://aws.amazon.com/blogs/database/migrate-self-managed-mariadb-to-amazon-aurora-mysql/ Migrate self-managed MariaDB to Amazon Aurora MySQL | AWS Database Blog Apr 6, 2022 - Amazon Aurora is a fully managed MySQL and PostgreSQL-compatible relational database, offered as part of the Amazon Relational Database Service (Amazon RDS).... amazon aurora mysqlself managedaws databasemigratemariadb https://grafana.com/products/bring-your-own-cloud-byoc/ Grafana BYOC | Fully managed observability in your AWS or GCP | Grafana Labs | Grafana Labs Fully managed observability in your AWS or GCP account. Use your CSP discounts and get all the benefits of Grafana Cloud. fully managedgrafanabyocobservability https://aws.amazon.com/marketplace/pp/prodview-h2lf6do2y4y4g AWS Marketplace: FortiAnalyzer Centralized Logging/Reporting (2 managed devices) Fortinet FortiAnalyzer offers enterprise class features to identify threats and provides flexibility to evolve along with your ever-changing network.... aws marketplacecentralized loggingfortianalyzerreportingmanaged https://aws.amazon.com/grafana/?nc=sn&loc=1 Grafana Dashboards - Amazon Managed Service for Grafana - AWS Amazon Managed Grafana helps you monitor and visualize metrics, logs, and trace from data sources such as Graphite, InfluxDB, Amazon Managed Service for... grafana dashboardsmanaged serviceamazonaws https://docs.aws.amazon.com/aws-managed-policy/latest/reference/AmazonEC2ImageReferencesAccessPolicy.html AmazonEC2ImageReferencesAccessPolicy - AWS Managed Policy About the AWS managed policy: AmazonEC2ImageReferencesAccessPolicy aws managedpolicy https://aws.amazon.com/marketplace/pp/prodview-qrrjx4vjm7osa AWS Marketplace: Cloudwatch Service Managed by IOanyT Innovations IOanyT Innovations provides CloudWatch services on the AWS marketplace, delivering businesses powerful monitoring tools and actionable insights for optimal... aws marketplacemanaged bycloudwatchserviceinnovations https://aws.amazon.com/marketplace/pp/prodview-idxx2xsrmx2we AWS Marketplace: Device Farm for Apps Service Managed by IOanyT Innovations "IOanyT Innovations offers a comprehensive AWS Device Farm for Apps service to streamline your app testing and optimization process. With our managed solution,... aws marketplacedevice farmfor appsmanaged by https://aws.amazon.com/marketplace/pp/prodview-36muijig42njo AWS Marketplace: Control Tower Service Managed by IOanyT Innovations IOanyT Innovations offers expert management of AWS Control Tower, a powerful AWS service that simplifies the setup and governance of multi-account AWS... aws marketplacecontrol towermanaged byserviceinnovations https://cratedb-toolkit.readthedocs.io/io/database/dms/managed.html AWS DMS Managed - CrateDB Toolkit About: Conduct a data migration from any source supported by AWS DMS into a database table on CrateDB or CrateDB Cloud, exclusively using managed... aws dmsmanagedcratedbtoolkit https://docs.aws.amazon.com/en_ca/eks/latest/userguide/security-iam-awsmanpol.html AWS managed policies for Amazon Elastic Kubernetes Service - Amazon EKS Learn about AWS managed policies for Amazon EKS and recent changes to those policies. aws managedfor amazonkubernetes servicepolicieselastic https://www.teracloud.io/ Cloud Computing Managed Services | Teracloud.io | AWS Partner Explore top-notch DevOps managed services and solutions from Teracloud. Optimize your workflow and enhance productivity with expert guidance. cloud computingmanaged servicesioawspartner https://aws.amazon.com/about-aws/whats-new/2025/11/sagemaker-hyperpod-managed-tiered-kv-cache/?ref=awsweekly.info SageMaker HyperPod now supports Managed tiered KV cache and intelligent routing - AWS Discover more about what's new at AWS with SageMaker HyperPod now supports Managed tiered KV cache and intelligent routing now supports https://docs.aws.amazon.com/aws-managed-policy/latest/reference/AWSIoTFleetHubFederationAccess.html AWSIoTFleetHubFederationAccess - AWS Managed Policy About the AWS managed policy: AWSIoTFleetHubFederationAccess aws managedpolicy https://aws.amazon.com/marketplace/pp/prodview-tlhuaivkoeer4 AWS Marketplace: Elastic Network Instance Service Managed by IOanyT Innovations IOanyT Innovations provides expertise in leveraging Elastic Network Interfaces (ENIs) on the AWS marketplace, ensuring enhanced networking capabilities for... aws marketplacemanaged byelasticnetworkinstance https://aws.amazon.com/marketplace/pp/prodview-kzvqsaqkfjck2 AWS Marketplace: RedProtect Managed Security for Web Apps and APIs RedProtect is a managed security service, which provides fully configured, tuned and managed industry-leading WAF and vulnerability scanning systems, with... aws marketplacemanaged securityfor webappsapis https://aws.amazon.com/blogs/training-and-certification/category/management-tools/amazon-managed-service-for-prometheus/ Amazon Managed Service for Prometheus | AWS Training and Certification Blog training and certificationmanaged serviceamazonprometheusaws https://aws.amazon.com/blogs/storage/changing-your-amazon-s3-encryption-from-s3-managed-encryption-sse-s3-to-aws-key-management-service-sse-kms/ Changing your Amazon S3 encryption from S3-Managed to AWS KMS | AWS Storage Blog Nov 20, 2020 - Customers who use Amazon Simple Storage Service (Amazon S3) often take advantage of S3-managed encryption keys (SSE-S3) for server-side object encryption... https://docs.aws.amazon.com/aws-managed-policy/latest/reference/AlexaForBusinessPolyDelegatedAccessPolicy.html AlexaForBusinessPolyDelegatedAccessPolicy - AWS Managed Policy About the AWS managed policy: AlexaForBusinessPolyDelegatedAccessPolicy aws managedpolicy https://docs.aws.amazon.com/aws-managed-policy/latest/reference/AmazonQFullAccess.html AmazonQFullAccess - AWS Managed Policy About the AWS managed policy: AmazonQFullAccess aws managedpolicy https://docs.aws.amazon.com/aws-managed-policy/latest/reference/AWSServiceCatalogSyncServiceRolePolicy.html AWSServiceCatalogSyncServiceRolePolicy - AWS Managed Policy About the AWS managed policy: AWSServiceCatalogSyncServiceRolePolicy aws managedpolicy https://aws.amazon.com/marketplace/pp/prodview-c463ngn7eoqbu AWS Marketplace: Orca Security Implementation and Managed Services by Abira Security Orca Security Full Deployment, Optimization and Management Services aws marketplaceorca securitymanaged servicesimplementationabira https://aws.amazon.com/marketplace/pp/prodview-ltfxvfdv27tpm AWS Marketplace: ElastiCache Service Managed by IOanyT Innovations IOanyT Innovations delivers ElastiCache services on the AWS marketplace, enabling businesses to boost the performance of their web applications with a scalable... aws marketplacemanaged byelasticacheserviceinnovations https://aws.amazon.com/about-aws/whats-new/2026/05/add-security-settings-stig-aws-microsoft-ad/ AWS Directory Service expands directory security settings with STIG-aligned controls for Managed AD... Discover more about what's new at AWS with AWS Directory Service expands directory security settings with STIG-aligned controls for Managed AD aws directory service https://aws.amazon.com/marketplace/pp/prodview-dsexhtwivnncs AWS Marketplace: G2 Review Managed Services G2 Review Managed Services (RMS) is a review collection platform that automates multi-channel outreach campaigns to help software companies consistently... aws marketplacereviewmanagedservices https://aws.amazon.com/blogs/mt/centralized-monitoring-and-alerting-for-aws-systems-manager-agent-status-on-managed-nodes-across-aws-organization/ Centralized monitoring and alerting for AWS Systems Manager Agent status on managed nodes across... Aug 4, 2025 - Has the AWS Systems Manager Agent (SSM Agent) running on your critical servers on-premises or on Amazon Elastic Compute Cloud (Amazon EC2) lost healthy... https://aws.amazon.com/id/about-aws/whats-new/2026/01/amazon-managed-grafana-aws-govcloud-us-regions/ Amazon Managed Grafana kini tersedia di Region AWS GovCloud (AS). - AWS Temukan selengkapnya tentang apa yang baru di AWS dengan Amazon Managed Grafana kini tersedia di Region AWS GovCloud (AS). amazon managed grafanakinitersediaregionaws https://www.aboutamazon.com/news/aws/bedrock-openai-models?lp=h1m OpenAI Models on Amazon Bedrock: AWS expands partnership with Codex and Managed Agents Apr 28, 2026 - AWS and OpenAI are bringing the latest OpenAI models to Amazon Bedrock, launching Codex on Amazon Bedrock, and launching Amazon Bedrock Managed Agents, powered... https://aws.amazon.com/marketplace/pp/prodview-6s4h7qk6xe4kg AWS Marketplace: KOLEKTO - Professional Implementation & Managed Services KOLEKTO Professional services is a solution for implementing and managing a comprehensive Sales Force Automation platform. Our expert team delivers tailored... aws marketplaceprofessional implementationkolektomanagedservices https://aws.amazon.com/marketplace/pp/prodview-d3uh2phvmfitq AWS Marketplace: Managed Services and Application Hosting Carimus provides AWS backed hosted solutions for powering mobile applications, internal business systems, web applications, and websites including headless CMS. aws marketplacemanaged servicesapplicationhosting https://aws.amazon.com/blogs/apn/identity-as-a-service-using-amazon-managed-blockchain-for-invisible-and-embedded-banking/ Identity-as-a-Service Using Amazon Managed Blockchain for Invisible and Embedded Banking | AWS... Feb 13, 2024 - The evolution of embedded and invisible banking has led to complex integrations between financial organizations and third-party platforms. To simplify identity... identity as a service https://www.nitinfotech.com/ Top Managed IT Services & AWS Cloud Consulting in Noida May 1, 2026 - NIT Infotech offers expert managed IT services and cloud solutions in Noida, specializing in AWS consulting for optimal business growth. top managed it servicesaws cloud consultingnoida https://aws.amazon.com/about-aws/whats-new/2025/10/amazon-ses-ip-observability-dedicated-op-addresses-managed/?ref=awsweekly.info Amazon SES adds IP observability for Dedicated IP addresses (managed) - AWS Discover more about what's new at AWS with Amazon SES adds IP observability for Dedicated IP addresses (managed) amazon sesaddsipobservabilitydedicated https://aws.amazon.com/blogs/big-data/category/analytics/amazon-managed-service-for-apache-flink/page/8/ Amazon Managed Service for Apache Flink | AWS Big Data Blog managed serviceapache flinkbig dataamazonaws https://smileitsolutions.uk/ AWS & Cloud Managed Services UK AWS Advanced Consulting Partner helping UK SMBs and SaaS companies cut AWS costs by 20-35%, ship faster and stay secure. Free 30-min Cloud Health Check — no... aws cloud managed servicesuk https://aws.amazon.com/marketplace/pp/prodview-ldkft55snqm54 AWS Marketplace: Load Testing Service Managed by IOanyT Innovations Measure and optimize the performance of your web applications with IOanyT Innovations' Load Testing Service on AWS. Simulate real-world user activity to... load testing serviceaws marketplacemanaged byinnovations https://docs.aws.amazon.com/aws-managed-policy/latest/reference/AWSServiceRoleForCloudWatchAlarmsActionSSMServiceRolePolicy.html AWSServiceRoleForCloudWatchAlarmsActionSSMServiceRolePolicy - AWS Managed Policy About the AWS managed policy: AWSServiceRoleForCloudWatchAlarmsActionSSMServiceRolePolicy aws managedpolicy https://aws.amazon.com/marketplace/pp/prodview-d4onzgei37bgk AWS Marketplace: Cloudology - AWS Cloud Modernization & Managed Services AWS cloud migrations, application modernization with AI-assisted development, and ongoing managed services for startups and mid-sized businesses seeking... aws marketplacecloud modernizationmanagedservices https://docs.aws.amazon.com/zh_tw/resource-explorer/latest/userguide/aws-managed-views.html AWS managed views - AWS Resource Explorer Learn how AWS managed views work in AWS Resource Explorer as a basis for search operations. aws managedviewsresourceexplorer https://aws.amazon.com/marketplace/pp/prodview-dp47lzgekgyte AWS Marketplace: Fully Managed, Secured, and Optimized Redis Fully automated RedisInsight AMI with first-boot setup, Docker, Apache, SSL, and optional domain mapping. aws marketplacefully managedsecuredoptimizedredis https://docs.aws.amazon.com/aws-managed-policy/latest/reference/AWSQuickSightListIAM.html AWSQuickSightListIAM - AWS Managed Policy About the AWS managed policy: AWSQuickSightListIAM aws managedpolicy