https://www.godaddy.com/en-uk/help/contact-managed-aws-support-at-godaddy-42715
Contact Managed AWS Support at GoDaddy | VPS Hosting - GoDaddy Help GB
Follow these steps to submit a support ticket for Managed Amazon Web Services (AWS) at GoDaddy.
managed awsvps hostingsupportgodaddyhelp
https://www.dpinfotech.net/
Cloud and IT infrastructure services, Managed aws and azure cloud, Linux Hosting, Windows hosting
Managed cloud and hosting services @price of unmanaged services offered by others Having the fully managed services make sense to get the best out of it for...
it infrastructure servicesmanaged awsazure linuxcloud
https://www.mgt-commerce.com/
Managed AWS Hosting for Magento Stores 2026
Jun 22, 2026 - MGT Commerce: 5,000+ Magento stores hosted on AWS since 2011. 4.9/5 rated. 0.3s load times, 99.99% uptime, free migration. Talk to our experts.
managed aws hostingfor magentostores
https://www.nublue.co.uk/
Managed AWS Cloud & GPU Hosting | Nublue
Fully managed AWS cloud hosting and GPU infrastructure for ambitious organisations. Enterprise-grade performance, without the operational complexity.
managed aws cloudgpu hosting
https://speedyrails.com/
Home - Speedyrails - Managed AWS Services
Dec 1, 2025 - Speedyrails is an AWS Advanced Tier Service Partner. We leverage our extensive AWS knowledge to provide exceptional managed services.
managed awsspeedyrailsservices
https://interpole.net/
InterPole Cloud – Web Hosting, Email, Managed Services, AWS Consultation
Web Hosting, Email, Managed Services, AWS Consultation
web hostingmanaged servicesinterpolecloudemail
https://aws.amazon.com/eks/
Managed Kubernetes Service - Amazon EKS - AWS
Amazon Elastic Kubernetes Service (EKS) is a managed service and certified Kubernetes conformant to run Kubernetes on AWS and on-premises.
managed kubernetes serviceamazon eksaws
https://ayeluya.com/
a-es - Managed WordPress Hosting Powered by Amazon AWS
managed wordpress hostingpowered byamazonaws
https://aws.amazon.com/managed-services/
AWS Managed Services
AWS Managed Services provides ongoing management of your AWS infrastructure so you can focus on your applications.
aws managedservices
https://aws.amazon.com/rds/
Fully Managed Relational Database – Amazon RDS – AWS
Amazon Relational Database Service (RDS) is a fully managed, open source cloud database service that allows you to easily operate and scale your relational...
fully managedrelational databaseamazon rdsaws
https://depot.dev/docs/managed/on-aws
Depot Managed on AWS | Depot Managed | Depot Documentation
Depot Managed allows you to deploy the Depot data plane in your own AWS account. This provides data residency, compliance, and cost control benefits.
depot managed on awsdocumentation
https://aws.amazon.com/about-aws/whats-new/2025/09/amazon-managed-service-prometheus-11-regions/
Amazon Managed Service for Prometheus now available in 11 additional AWS Regions - AWS
Discover more about what's new at AWS with Amazon Managed Service for Prometheus now available in 11 additional AWS Regions
managed servicenow available
https://aws.amazon.com/blogs/aws/category/application-integration/amazon-managed-workflows-for-apache-airflow-amazon-mwaa/
Amazon Managed Workflows for Apache Airflow (Amazon MWAA) | AWS News Blog
apache airflowaws newsamazonmanagedworkflows
https://aws.amazon.com/it/about-aws/whats-new/2019/11/introducing-aws-managed-rules-for-aws-waf/
Presentazione di AWS Managed Rules per AWS WAF
aws managedpresentazionedirulesper
https://aws.amazon.com/marketplace/pp/prodview-kgoif64v2ct3g
AWS Marketplace: eCloudvalley SecurityPilot Managed EDR Service
eCloudvalley SecurityPilot is a professional Managed Detection and Response (MDR) service. By combining cutting-edge detection technology with an intuitive...
aws marketplacemanaged edrservice
https://docs.aws.amazon.com/security-ir/latest/userguide/aws-managed-policies.html
AWS Managed Policies - AWS Security Incident Response User Guide
Learn about AWS managed policies for AWS Security Incident Response and recent changes to those policies.
security incident responseaws managedpoliciesuserguide
https://aws.amazon.com/blogs/mt/enhancing-observability-with-a-managed-monitoring-solution-for-amazon-eks/
Enhancing observability with a managed monitoring solution for Amazon EKS | AWS Cloud Operations...
Aug 4, 2025 - Introduction Keeping a watchful eye on your Kubernetes infrastructure is crucial for ensuring optimal performance, identifying bottlenecks, and troubleshooting...
https://aws.amazon.com/marketplace/pp/prodview-bdijvqo73ft2m
AWS Marketplace: Managed AWS Direct Connect for regulated markets
Available in over 100 locations globally, Continent 8's Cloud Connect service is a specialised solution that provides a direct, private and secure connection...
aws marketplacedirect connectmanagedregulatedmarkets
https://docs.aws.amazon.com/codebuild/latest/userguide/buildkite-runner.html
Self-managed Buildkite runner in AWS CodeBuild - AWS CodeBuild
Learn about setting up self-managed Buildkite runner in AWS CodeBuild.
self managedbuildkiterunnerawscodebuild
https://aws.amazon.com/about-aws/whats-new/2025/08/amazon-managed-service-for-apache-flink-cmk-support/
Amazon Managed Service for Apache Flink now supports Customer Managed Keys (CMK) - AWS
Discover more about what's new at AWS with Amazon Managed Service for Apache Flink now supports Customer Managed Keys (CMK)
managed serviceapache flink
https://aws.amazon.com/marketplace/pp/prodview-xpu4blw6pgynk?sr=0-11&ref_=beagle&applicationId=AWSMPContessahttp://
AWS Marketplace: Managed Keycloak
Managed Keycloak is a complete enterprise solution delivered by Solodev that provides setup, custom branding, maintenance, and U.S.-based support for Keycloak...
aws marketplacemanagedkeycloak
https://aws.amazon.com/marketplace/pp/prodview-lfhcenjy6ywgw
AWS Marketplace: Fortinet Managed IPS Rules for AWS Network Firewall
Enhance AWS Network Firewall with AI-driven intrusion prevention. Fortinet Managed IPS Rules deliver automated, continuously updated protection from exploits,...
aws marketplacefortinetmanagedipsrules
https://aws.amazon.com/marketplace/pp/prodview-v6lt3hvxpdoni
AWS Marketplace: AWS Managed Services
Comprehensive management of your AWS environment to ensure optimal performance, security, and cost-efficiency, allowing you to focus on your core business...
aws marketplacemanagedservices
https://docs.aws.amazon.com/aws-managed-policy/latest/reference/AWSMarketplaceAmiIngestion.html
AWSMarketplaceAmiIngestion - AWS Managed Policy
About the AWS managed policy: AWSMarketplaceAmiIngestion
aws managedpolicy
https://aws.amazon.com/about-aws/whats-new/2023/12/customer-managed-key-support-aws-codecommit/
Announcing Customer Managed Key (CMK) support in AWS CodeCommit - AWS
Discover more about what's new at AWS with Announcing Customer Managed Key (CMK) support in AWS CodeCommit
customer managed keyannouncingcmksupportaws
https://aws.amazon.com/about-aws/whats-new/2024/06/amazon-ecs-aws-fargate-encrypt-ephemeral-storage-customer-managed-kms-keys/
Amazon ECS on AWS Fargate now allows you to encrypt ephemeral storage with customer-managed KMS...
Discover more about what's new at AWS with Amazon ECS on AWS Fargate now allows you to encrypt ephemeral storage with customer-managed KMS keys
https://aws.amazon.com/marketplace/pp/prodview-6mbnnj3pgwfzo
AWS Marketplace: Managed Cloud Operations
Eliminate the innovation tax with this automation-first Managed Cloud Operations service. Built to AWS Well-Architected standards, our solution combines AWS...
aws marketplacemanaged cloudoperations
https://aws.amazon.com/blogs/architecture/audit-your-supply-chain-with-amazon-managed-blockchain/
Audit Your Supply Chain with Amazon Managed Blockchain | AWS Architecture Blog
Jun 25, 2021 - For manufacturing companies, visibility into complex supply chain processes is critical to establishing resilient supply chain management. Being able to trace...
amazon managed blockchainaws architectureauditsupply
https://aws.amazon.com/marketplace/reviews/reviews-list/B081SK32C7?rating=4&sort=NEWEST&filter=ALL&page=2
AWS Marketplace: Fortinet Managed Rules for AWS WAF - Complete OWASP Top 10 Reviews
aws marketplacemanaged rules
https://aws.amazon.com/marketplace/pp/prodview-xf66bgecponas
AWS Marketplace: Elemental Service Managed by IOanyT Innovations
Elemental Service managed by IOanyT Innovations offers cloud-based video processing, optimized for high-quality media streaming and tailored for the modern web.
aws marketplacemanaged byelementalserviceinnovations
https://aws.amazon.com/marketplace/pp/prodview-eiihlwyuorj5q
AWS Marketplace: AWS Key Management Service Managed by IOanyT Innovations
IOanyT Innovations: Premier AWS Key Management Service on AWS Marketplace. Streamlined cryptographic solutions to protect and control access to your data...
key management serviceaws marketplacemanaged byinnovations
https://aws.amazon.com/blogs/apn/what-are-managed-services-in-the-hyperscale-cloud/
What are Managed Services in the Hyperscale Cloud? | AWS Partner Network (APN) Blog
https://aws.amazon.com/blogs/big-data/how-flutter-uki-optimizes-data-pipelines-with-aws-managed-workflows-for-apache-airflow/
How Flutter UKI optimizes data pipelines with AWS Managed Workflows for Apache Airflow | AWS Big...
May 9, 2025 - In this post, we share how Flutter UKI transitioned from a monolithic Amazon Elastic Compute Cloud (Amazon EC2)-based Airflow setup to a scalable and optimized...
https://aws.amazon.com/it/about-aws/whats-new/2019/10/aws-managed-services-ams-simplifies-servicenow-integration/
AWS Managed Services (AMS) semplifica l'integrazione ServiceNow
aws managed servicesamslintegrazioneservicenow
https://repost.aws/knowledge-center/waf-managed-rules-count-to-block?sc_ichannel=ha&sc_ilang=en&sc_isite=repost&sc_iplace=hp&sc_icontent=AAJ2nc18g3RL2cRRIzUniecg&sc_ipos=2
Transition AWS WAF managed rules from Count to Block mode | AWS re:Post
Jul 8, 2026 - I want to transition AWS WAF managed rules from Count mode to Block mode, but I don't want to disrupt traffic.
aws wafmanaged rules
https://docs.aws.amazon.com/it_it/directoryservice/latest/admin-guide/ms_ad_getting_started.html
Guida introduttiva a AWS Managed Microsoft AD - AWS Directory Service
Scopri i prerequisiti per AWS Managed Microsoft AD e come creare un AWS Managed Microsoft AD Active Directory.
guida introduttivaaws managedmicrosoft addirectoryservice
https://aws.amazon.com/about-aws/whats-new/2021/05/amazon-cloudwatch-logs-service-limits-can-now-be-managed-with-aws-service-quotas/
Amazon CloudWatch Logs service limits can now be managed with AWS Service Quotas - AWS
Discover more about what's new at AWS with Amazon CloudWatch Logs service limits can now be managed with AWS Service Quotas
amazon cloudwatch logsservice limits
https://aws.amazon.com/marketplace/pp/prodview-jx4xumyu4okgc
AWS Marketplace: Managed XDR
Managed XDR by Check Point Services (formerly Infinity Global Services) integrates telemetry from Check Point and supported third party sources to deliver...
aws marketplacemanagedxdr
https://aws.amazon.com/marketplace/pp/prodview-gtewe4whd3qno
AWS Marketplace: Managed Snapshot Cleanup
Profile and categorize EBS snapshots within your AWS environment, and, once these snapshots are reviewed, perform automated cleanups of older and unused...
aws marketplacemanagedsnapshotcleanup
https://aws.amazon.com/about-aws/whats-new/2026/04/amazon-managed-grafana-v12-create/
Amazon Managed Grafana now supports creating Grafana 12.4 workspaces - AWS
Discover more about what's new at AWS with Amazon Managed Grafana now supports creating Grafana 12.4 workspaces
amazon managed grafananow supportscreatingworkspacesaws
https://aws.amazon.com/about-aws/whats-new/2022/10/aws-app-runner-support-php-go-dot-net-ruby-managed-runtimes/
AWS App Runner launches support for PHP, Go, .Net, and Ruby managed runtimes - AWS
Discover more about what's new at AWS with AWS App Runner launches support for PHP, Go, .Net, and Ruby managed runtimes
aws app runner
https://www.cloudhesive.com/
CloudHesive | AWS Cloud Solutions and Managed Services
Jun 25, 2026 - CloudHesive offers AWS cloud solutions and managed services to empower your business with migrations, cloud security, and innovation.
aws cloud solutionsmanagedservices
https://docs.aws.amazon.com/aws-managed-policy/latest/reference/AWSThinkboxAWSPortalAdminPolicy.html
AWSThinkboxAWSPortalAdminPolicy - AWS Managed Policy
About the AWS managed policy: AWSThinkboxAWSPortalAdminPolicy
aws managedpolicy
https://aws.amazon.com/marketplace/pp/prodview-hb4dxdg3zqpoe
AWS Marketplace: Managed Services - Managed Detection and Response
The "Manage Detect and Respond Services" provided by Driven Technologies are at the forefront of cybersecurity innovation, utilizing advanced technologies such...
aws marketplacemanaged servicesdetectionresponse
https://aws.amazon.com/marketplace/pp/prodview-6wqgzwd4cl7fg
AWS Marketplace: 24x7 Managed Security Services (Palo Alto Networks, Fortinet)
As cybersecurity challenges continue to grow in scale, scope and complexity, it is too important to leave it to chance, instead, leave it to the experts! MSSPs...
managed security servicespalo alto networksaws marketplacefortinet
https://aws.amazon.com/marketplace/pp/prodview-hffpy7pmvszxe
AWS Marketplace: Data Streaming Architecture Service Managed by IOanyT Innovations
Data Streaming Architecture refers to the framework and processes designed to efficiently collect, process, and deliver real-time data from various sources to...
aws marketplacedata streamingarchitecture servicemanaged byinnovations
https://www.sas.com/en_gb/news/press-releases/2024/april/sas-expands-hosted-managed-services-to-aws.html
SAS expands hosted managed services to AWS | SAS UK
Data and artificial intelligence (AI) leader SAS has officially expanded its SAS-hosted managed services to Amazon Web Services (AWS).
managed servicessasexpandshostedaws
https://aws.amazon.com/blogs/big-data/create-cross-account-custom-amazon-managed-grafana-dashboards-for-amazon-redshift/
Create cross-account, custom Amazon Managed Grafana dashboards for Amazon Redshift | AWS Big Data...
Jun 22, 2022 - Amazon Managed Grafana recently announced a new data source plugin for Amazon Redshift, enabling you to query, visualize, and alert on your Amazon Redshift...
amazon managed grafana
https://github.com/aws/aws-codebuild-docker-images
GitHub - aws/aws-codebuild-docker-images: Official AWS CodeBuild repository for managed Docker...
Official AWS CodeBuild repository for managed Docker images http://docs.aws.amazon.com/codebuild/latest/userguide/build-env-ref.html -...
aws codebuilddocker imagesofficial repositorygithubmanaged
https://aws.amazon.com/about-aws/whats-new/2024/02/amazon-managed-blockchain-query-access-non-finalized-blockchain-data/
Amazon Managed Blockchain Query now provides access to non-finalized blockchain data - AWS
Discover more about what's new at AWS with Amazon Managed Blockchain Query now provides access to non-finalized blockchain data
amazon managed blockchainquery now
https://docs.aws.amazon.com/elasticbeanstalk/latest/dg/using-service-linked-roles-managedupdates.html
The managed-updates service-linked role - AWS Elastic Beanstalk
How to use service-linked roles to give Elastic Beanstalk access to resources in your AWS account.
managed updatesservicelinkedroleaws
https://aws.amazon.com/marketplace/pp/prodview-g2hf6dat7dmwu
AWS Marketplace: Funded VMware Migration with Managed CloudOps by Opti9
The Funded VMware Migration with Managed CloudOps by Opti9 helps VMware users escape rising costs, limited flexibility, and mounting technical debt by...
aws marketplacevmware migrationfundedmanagedcloudops
https://aws.amazon.com/marketplace/pp/prodview-4nkqqahmre23e
AWS Marketplace: AWS WAF Managed Service by Ness
Enhance and Manage Your Web Security with Ness. Our AWS WAF Managed Service provides ongoing robust security for your web applications, ensuring continuous...
aws marketplacemanaged servicewafness
https://aws.amazon.com/blogs/database/how-coupa-migrated-from-a-self-hosted-redis-to-fully-managed-amazon-elasticache/
How Coupa migrated from a self-hosted Redis to fully managed Amazon ElastiCache | AWS Database Blog
Nov 9, 2021 - This is a guest post by Ramesh Sencha, Lead Cloud Engineer at Coupa. Coupa Software (NASDAQ: COUP) is a leader in Business Spend Management (BSM). Coupa...
https://aws.amazon.com/marketplace/pp/prodview-oudupa3s53yjc
AWS Marketplace: [IN] Redington AWS Managed services-As-Product
A standardized, outcome driven managed cloud offering built on Amazon Web Services to ensure secure, reliable, and cost-optimized operations. It delivers 24x7...
aws marketplacemanaged servicesredingtonproduct
https://aws.amazon.com/marketplace/pp/prodview-x5kqvlye2273u
AWS Marketplace: EnCloud Comprehensive Cloud Managed Services
A complete managed services solution. EnCloud provides expert cloud governance, operations, security management, and cost optimization to streamline your...
aws marketplacecloud managedcomprehensiveservices
https://master.cds.hku.hk/service/aws-managed-services/
AWS Managed Services - HKU, School of Computing and Data Science, Taught Master Programmes
Nov 18, 2025 - Network Infrastructure and Design Network infrastructure and design are the backbone of modern businesses, serving as the foundation upon which all digital...
computing and data scienceaws managed services
https://docs.aws.amazon.com/id_id/mwaa/latest/userguide/samples-secrets-manager.html
Menggunakan kunci rahasia AWS Secrets Manager untuk koneksi Apache Airflow - Amazon Managed...
Contoh panggilan berikut AWS Secrets Manager untuk mendapatkan kunci rahasia untuk koneksi Apache Airflow di Amazon Managed Workflows untuk Apache Airflow.
aws secrets manager
https://aws.amazon.com/blogs/database/migrate-self-managed-mariadb-to-amazon-aurora-mysql/
Migrate self-managed MariaDB to Amazon Aurora MySQL | AWS Database Blog
Apr 6, 2022 - Amazon Aurora is a fully managed MySQL and PostgreSQL-compatible relational database, offered as part of the Amazon Relational Database Service (Amazon RDS)....
amazon aurora mysqlself managedaws databasemigratemariadb
https://grafana.com/products/bring-your-own-cloud-byoc/
Grafana BYOC | Fully managed observability in your AWS or GCP | Grafana Labs | Grafana Labs
Fully managed observability in your AWS or GCP account. Use your CSP discounts and get all the benefits of Grafana Cloud.
fully managedgrafanabyocobservability
https://aws.amazon.com/marketplace/pp/prodview-h2lf6do2y4y4g
AWS Marketplace: FortiAnalyzer Centralized Logging/Reporting (2 managed devices)
Fortinet FortiAnalyzer offers enterprise class features to identify threats and provides flexibility to evolve along with your ever-changing network....
aws marketplacecentralized loggingfortianalyzerreportingmanaged
https://aws.amazon.com/grafana/?nc=sn&loc=1
Grafana Dashboards - Amazon Managed Service for Grafana - AWS
Amazon Managed Grafana helps you monitor and visualize metrics, logs, and trace from data sources such as Graphite, InfluxDB, Amazon Managed Service for...
grafana dashboardsmanaged serviceamazonaws
https://docs.aws.amazon.com/aws-managed-policy/latest/reference/AmazonEC2ImageReferencesAccessPolicy.html
AmazonEC2ImageReferencesAccessPolicy - AWS Managed Policy
About the AWS managed policy: AmazonEC2ImageReferencesAccessPolicy
aws managedpolicy
https://aws.amazon.com/marketplace/pp/prodview-qrrjx4vjm7osa
AWS Marketplace: Cloudwatch Service Managed by IOanyT Innovations
IOanyT Innovations provides CloudWatch services on the AWS marketplace, delivering businesses powerful monitoring tools and actionable insights for optimal...
aws marketplacemanaged bycloudwatchserviceinnovations
https://aws.amazon.com/marketplace/pp/prodview-idxx2xsrmx2we
AWS Marketplace: Device Farm for Apps Service Managed by IOanyT Innovations
"IOanyT Innovations offers a comprehensive AWS Device Farm for Apps service to streamline your app testing and optimization process. With our managed solution,...
aws marketplacedevice farmfor appsmanaged by
https://aws.amazon.com/marketplace/pp/prodview-36muijig42njo
AWS Marketplace: Control Tower Service Managed by IOanyT Innovations
IOanyT Innovations offers expert management of AWS Control Tower, a powerful AWS service that simplifies the setup and governance of multi-account AWS...
aws marketplacecontrol towermanaged byserviceinnovations
https://cratedb-toolkit.readthedocs.io/io/database/dms/managed.html
AWS DMS Managed - CrateDB Toolkit
About: Conduct a data migration from any source supported by AWS DMS into a database table on CrateDB or CrateDB Cloud, exclusively using managed...
aws dmsmanagedcratedbtoolkit
https://docs.aws.amazon.com/en_ca/eks/latest/userguide/security-iam-awsmanpol.html
AWS managed policies for Amazon Elastic Kubernetes Service - Amazon EKS
Learn about AWS managed policies for Amazon EKS and recent changes to those policies.
aws managedfor amazonkubernetes servicepolicieselastic
https://www.teracloud.io/
Cloud Computing Managed Services | Teracloud.io | AWS Partner
Explore top-notch DevOps managed services and solutions from Teracloud. Optimize your workflow and enhance productivity with expert guidance.
cloud computingmanaged servicesioawspartner
https://aws.amazon.com/about-aws/whats-new/2025/11/sagemaker-hyperpod-managed-tiered-kv-cache/?ref=awsweekly.info
SageMaker HyperPod now supports Managed tiered KV cache and intelligent routing - AWS
Discover more about what's new at AWS with SageMaker HyperPod now supports Managed tiered KV cache and intelligent routing
now supports
https://docs.aws.amazon.com/aws-managed-policy/latest/reference/AWSIoTFleetHubFederationAccess.html
AWSIoTFleetHubFederationAccess - AWS Managed Policy
About the AWS managed policy: AWSIoTFleetHubFederationAccess
aws managedpolicy
https://aws.amazon.com/marketplace/pp/prodview-tlhuaivkoeer4
AWS Marketplace: Elastic Network Instance Service Managed by IOanyT Innovations
IOanyT Innovations provides expertise in leveraging Elastic Network Interfaces (ENIs) on the AWS marketplace, ensuring enhanced networking capabilities for...
aws marketplacemanaged byelasticnetworkinstance
https://aws.amazon.com/marketplace/pp/prodview-kzvqsaqkfjck2
AWS Marketplace: RedProtect Managed Security for Web Apps and APIs
RedProtect is a managed security service, which provides fully configured, tuned and managed industry-leading WAF and vulnerability scanning systems, with...
aws marketplacemanaged securityfor webappsapis
https://aws.amazon.com/blogs/training-and-certification/category/management-tools/amazon-managed-service-for-prometheus/
Amazon Managed Service for Prometheus | AWS Training and Certification Blog
training and certificationmanaged serviceamazonprometheusaws
https://aws.amazon.com/blogs/storage/changing-your-amazon-s3-encryption-from-s3-managed-encryption-sse-s3-to-aws-key-management-service-sse-kms/
Changing your Amazon S3 encryption from S3-Managed to AWS KMS | AWS Storage Blog
Nov 20, 2020 - Customers who use Amazon Simple Storage Service (Amazon S3) often take advantage of S3-managed encryption keys (SSE-S3) for server-side object encryption...
https://docs.aws.amazon.com/aws-managed-policy/latest/reference/AlexaForBusinessPolyDelegatedAccessPolicy.html
AlexaForBusinessPolyDelegatedAccessPolicy - AWS Managed Policy
About the AWS managed policy: AlexaForBusinessPolyDelegatedAccessPolicy
aws managedpolicy
https://docs.aws.amazon.com/aws-managed-policy/latest/reference/AmazonQFullAccess.html
AmazonQFullAccess - AWS Managed Policy
About the AWS managed policy: AmazonQFullAccess
aws managedpolicy
https://docs.aws.amazon.com/aws-managed-policy/latest/reference/AWSServiceCatalogSyncServiceRolePolicy.html
AWSServiceCatalogSyncServiceRolePolicy - AWS Managed Policy
About the AWS managed policy: AWSServiceCatalogSyncServiceRolePolicy
aws managedpolicy
https://aws.amazon.com/marketplace/pp/prodview-c463ngn7eoqbu
AWS Marketplace: Orca Security Implementation and Managed Services by Abira Security
Orca Security Full Deployment, Optimization and Management Services
aws marketplaceorca securitymanaged servicesimplementationabira
https://aws.amazon.com/marketplace/pp/prodview-ltfxvfdv27tpm
AWS Marketplace: ElastiCache Service Managed by IOanyT Innovations
IOanyT Innovations delivers ElastiCache services on the AWS marketplace, enabling businesses to boost the performance of their web applications with a scalable...
aws marketplacemanaged byelasticacheserviceinnovations
https://aws.amazon.com/about-aws/whats-new/2026/05/add-security-settings-stig-aws-microsoft-ad/
AWS Directory Service expands directory security settings with STIG-aligned controls for Managed AD...
Discover more about what's new at AWS with AWS Directory Service expands directory security settings with STIG-aligned controls for Managed AD
aws directory service
https://aws.amazon.com/marketplace/pp/prodview-dsexhtwivnncs
AWS Marketplace: G2 Review Managed Services
G2 Review Managed Services (RMS) is a review collection platform that automates multi-channel outreach campaigns to help software companies consistently...
aws marketplacereviewmanagedservices
https://aws.amazon.com/blogs/mt/centralized-monitoring-and-alerting-for-aws-systems-manager-agent-status-on-managed-nodes-across-aws-organization/
Centralized monitoring and alerting for AWS Systems Manager Agent status on managed nodes across...
Aug 4, 2025 - Has the AWS Systems Manager Agent (SSM Agent) running on your critical servers on-premises or on Amazon Elastic Compute Cloud (Amazon EC2) lost healthy...
https://aws.amazon.com/id/about-aws/whats-new/2026/01/amazon-managed-grafana-aws-govcloud-us-regions/
Amazon Managed Grafana kini tersedia di Region AWS GovCloud (AS). - AWS
Temukan selengkapnya tentang apa yang baru di AWS dengan Amazon Managed Grafana kini tersedia di Region AWS GovCloud (AS).
amazon managed grafanakinitersediaregionaws
https://www.aboutamazon.com/news/aws/bedrock-openai-models?lp=h1m
OpenAI Models on Amazon Bedrock: AWS expands partnership with Codex and Managed Agents
Apr 28, 2026 - AWS and OpenAI are bringing the latest OpenAI models to Amazon Bedrock, launching Codex on Amazon Bedrock, and launching Amazon Bedrock Managed Agents, powered...
https://aws.amazon.com/marketplace/pp/prodview-6s4h7qk6xe4kg
AWS Marketplace: KOLEKTO - Professional Implementation & Managed Services
KOLEKTO Professional services is a solution for implementing and managing a comprehensive Sales Force Automation platform. Our expert team delivers tailored...
aws marketplaceprofessional implementationkolektomanagedservices
https://aws.amazon.com/marketplace/pp/prodview-d3uh2phvmfitq
AWS Marketplace: Managed Services and Application Hosting
Carimus provides AWS backed hosted solutions for powering mobile applications, internal business systems, web applications, and websites including headless CMS.
aws marketplacemanaged servicesapplicationhosting
https://aws.amazon.com/blogs/apn/identity-as-a-service-using-amazon-managed-blockchain-for-invisible-and-embedded-banking/
Identity-as-a-Service Using Amazon Managed Blockchain for Invisible and Embedded Banking | AWS...
Feb 13, 2024 - The evolution of embedded and invisible banking has led to complex integrations between financial organizations and third-party platforms. To simplify identity...
identity as a service
https://www.nitinfotech.com/
Top Managed IT Services & AWS Cloud Consulting in Noida
May 1, 2026 - NIT Infotech offers expert managed IT services and cloud solutions in Noida, specializing in AWS consulting for optimal business growth.
top managed it servicesaws cloud consultingnoida
https://aws.amazon.com/about-aws/whats-new/2025/10/amazon-ses-ip-observability-dedicated-op-addresses-managed/?ref=awsweekly.info
Amazon SES adds IP observability for Dedicated IP addresses (managed) - AWS
Discover more about what's new at AWS with Amazon SES adds IP observability for Dedicated IP addresses (managed)
amazon sesaddsipobservabilitydedicated
https://aws.amazon.com/blogs/big-data/category/analytics/amazon-managed-service-for-apache-flink/page/8/
Amazon Managed Service for Apache Flink | AWS Big Data Blog
managed serviceapache flinkbig dataamazonaws
https://smileitsolutions.uk/
AWS & Cloud Managed Services UK
AWS Advanced Consulting Partner helping UK SMBs and SaaS companies cut AWS costs by 20-35%, ship faster and stay secure. Free 30-min Cloud Health Check — no...
aws cloud managed servicesuk
https://aws.amazon.com/marketplace/pp/prodview-ldkft55snqm54
AWS Marketplace: Load Testing Service Managed by IOanyT Innovations
Measure and optimize the performance of your web applications with IOanyT Innovations' Load Testing Service on AWS. Simulate real-world user activity to...
load testing serviceaws marketplacemanaged byinnovations
https://docs.aws.amazon.com/aws-managed-policy/latest/reference/AWSServiceRoleForCloudWatchAlarmsActionSSMServiceRolePolicy.html
AWSServiceRoleForCloudWatchAlarmsActionSSMServiceRolePolicy - AWS Managed Policy
About the AWS managed policy: AWSServiceRoleForCloudWatchAlarmsActionSSMServiceRolePolicy
aws managedpolicy
https://aws.amazon.com/marketplace/pp/prodview-d4onzgei37bgk
AWS Marketplace: Cloudology - AWS Cloud Modernization & Managed Services
AWS cloud migrations, application modernization with AI-assisted development, and ongoing managed services for startups and mid-sized businesses seeking...
aws marketplacecloud modernizationmanagedservices
https://docs.aws.amazon.com/zh_tw/resource-explorer/latest/userguide/aws-managed-views.html
AWS managed views - AWS Resource Explorer
Learn how AWS managed views work in AWS Resource Explorer as a basis for search operations.
aws managedviewsresourceexplorer
https://aws.amazon.com/marketplace/pp/prodview-dp47lzgekgyte
AWS Marketplace: Fully Managed, Secured, and Optimized Redis
Fully automated RedisInsight AMI with first-boot setup, Docker, Apache, SSL, and optional domain mapping.
aws marketplacefully managedsecuredoptimizedredis
https://docs.aws.amazon.com/aws-managed-policy/latest/reference/AWSQuickSightListIAM.html
AWSQuickSightListIAM - AWS Managed Policy
About the AWS managed policy: AWSQuickSightListIAM
aws managedpolicy