Robuta

https://journals.plos.org/plosone/article?id=10.1371/journal.pone.0353122 Social marginalization risk and its negative association with socialising preferences in Japanese... For people with a high risk of social withdrawal, such as Japanese “hikikomori” or NEET, socialising with others can be demanding. For some, however, an... negative association https://diff.wikimedia.org/2025/11/27/how-citizen-archivists-in-south-asia-confront-the-online-marginalization-of-oral-cultures-and-languages/ How citizen archivists in South Asia confront the online marginalization of oral cultures and... Dec 2, 2025 - Recording of Bisukallu song. Image via Wikipedia by Santhosh Notagar99. CC0. What can an O Bele folk song from the Tulu community in southern India tell us... https://sshrc-crsh.canada.ca/news_room-salle_de_presse/latest_news-nouvelles_recentes/2022/ksg_sdpm-ssc_edpm-eng.aspx Funding opportunity: Shifting Dynamics of Privilege and Marginalization Social Sciences and Humanities Research Council funding opportunityshiftingdynamicsprivilegemarginalization https://journalhosting.ucalgary.ca/index.php/cmej/article/view/71790/version/26799 When a Canadian is not a Canadian: marginalization of IMGs in the CaRMS match | Canadian Medical... https://americandiplomacy.web.unc.edu/2018/03/militarization-and-marginalization-of-american-diplomacy-and-foreign-policy Militarization and Marginalization of American Diplomacy and Foreign Policy | American Diplomacy... militarizationmarginalizationamericandiplomacyforeign https://healtheducationresources.unesco.org/fr/library/documents/power-marginalization-and-school-re-entry-teenage-mothers-tanzania Power, marginalization, and school re-entry for teenage mothers in Tanzania | Centre de ressources... https://www.joelle-leandre.com/ Joelle Leandre | Women Of Jazz / Musicality, Femininity, Marginalization. women ofjoelleleandrejazzmusicality https://arxiv.org/abs/2310.12920 [2310.12920] Generative Marginalization Models Abstract page for arXiv paper 2310.12920: Generative Marginalization Models generativemarginalizationmodels https://ideas.repec.org/p/fth/tilbur/9312.html Marginalization and Contemporaneous Aggregation in Multivariate Garch Processes No abstract is available for this item. marginalizationcontemporaneousaggregationmultivariategarch https://scholars.duke.edu/publication/652110 Scholars@Duke publication: Kernel density estimation and marginalization consistency kernel density estimationscholarsdukepublicationmarginalization https://clacls.gc.cuny.edu/living-in-limbo-inefficient-processing-insufficient-housing-informality-and-marginalization-nycs-migrants-crises/ Living in Limbo: Inefficient Processing, Insufficient Housing, Informality and Marginalization,... living in limboinefficientprocessinginsufficienthousing https://experts.illinois.edu/en/publications/refusing-misrecognition-navigating-multiple-marginalization-in-th/ Refusing (Mis)Recognition: Navigating Multiple Marginalization in the U.S. Two Spirit Movement -... https://epub.ub.uni-muenchen.de/113193/ Dark Energy Survey Year 3 results: marginalization over redshift distribution uncertainties using... dark energy https://blogs.worldbank.org/en/arabvoices/marginalization-inclusion-story-waste-pickers-west-bank From marginalization to inclusion: The story of the waste pickers in the West Bank About a decade ago, we started a project to improve solid waste management for waste pickers like Ibrahim and the 840, 000 people in the southern West Bank... the story of https://urbanedjournal.gse.upenn.edu/archive/volume-13-issue-1-spring-2016/surveillance-violence-and-marginalization-students-color Surveillance, Violence, and the Marginalization of Students of Color | Penn GSE Perspectives on... and the https://cosmicx.blogspot.com/2005/01/continuing-marginalization-of.html Cosmic X in Jerusalem: The Continuing Marginalization of the Religious Zionists Religious Zionists were just recovering from the Education Ministry's lame attempt to discriminate against Yehiva University graduates, wh... cosmic xjerusalemcontinuingmarginalizationreligious https://indigenousfoundations.web.arts.ubc.ca/marginalization_of_aboriginal_women/ Marginalization of Aboriginal women | indigenousfoundations A Brief History of the Marginalization of Aboriginal Women in Canada Aboriginal women in Canada frequently experience challenges and discrimination that are... aboriginal womenmarginalization https://ucrisportal.univie.ac.at/en/publications/consumer-search-and-double-marginalization-2/ Consumer search and double marginalization - University of Vienna consumer searchuniversity ofdoublemarginalizationvienna https://hspop.uw.edu/publication/socioeconomic-marginalization-and-opioid-related-overdose-a-systematic-review/ Socioeconomic marginalization and opioid-related overdose: A systematic review. - Health Systems... van Draanen J, Tsang C, Mitra S, Karamouzian M, Richardson L. Socioeconomic marginalization and opioid-related overdose: A systematic review. Drug Alcohol... systematic reviewsocioeconomicmarginalizationopioidrelated https://podcasts.ox.ac.uk/information-technologies-and-marginalization-african-market-economies Information Technologies and Marginalization in African Market Economies | University of Oxford... It is often argued that poor and marginalized communities self perpetuate their poverty by inhabiting closed networks. This argument has been most strongly... information technologiesafrican marketuniversity ofmarginalization https://carnegieendowment.org/middle-east/research/2024/01/misfortune-to-marginalization-the-geopolitical-impact-of-structural-economic-failings-in-egypt-tunisia-and-lebanon Misfortune to Marginalization: The Geopolitical Impact of Structural Economic Failings in Egypt,... Dec 4, 2025 - The food, energy, and debt crises in the Middle East and North Africa have exacerbated structural economic weaknesses of low- and middle-income... https://scholarworks.uvm.edu/items/9b5bfa64-5c1b-4411-9c58-f321db13756c Releasing Our Voices: Confronting Marginalization in the Academy A voice resonates most brilliantly when it breaks through a drastic and long-held silence. Such is the reality of many marginalized and oppressed peoples... our voicesin thereleasingconfrontingmarginalization https://pubmed.ncbi.nlm.nih.gov/24982511/ Equity or Marginalization? The High School Course-Taking of Students Labeled with a Learning... Placement of some students into the courses needed only for high school graduation, and others into those that prepare them for college constitutes academic... https://pure.lib.usf.edu/en/publications/does-educational-marginalization-mediate-the-path-from-childhood--2/ Does Educational Marginalization Mediate the Path from Childhood Cumulative Risk to Criminal... the path https://journalhosting.ucalgary.ca/index.php/jisd/article/view/78933 A Qualitative Study of Traditional Healers and Their Experiences of Marginalization by Biomedical... qualitative studytraditional healers https://scholarworks.iu.edu/journals/index.php/jsriue/article/view/35694 Examination of Healthcare Marginalization of Women. | Journal of Student Research at Indiana... student researchexaminationhealthcaremarginalizationwomen https://humanrights.fhi.duke.edu/news/itaewons-others-stories-navigating-authority-and-marginalization/ Itaewon's 'Others:' Stories of Navigating Authority and Marginalization | Duke Human Rights Center... Matthew Joo is an International Comparative Studies and Political Science major in the class of 2026. https://carnegieendowment.org/china/research/2024/01/misfortune-to-marginalization-the-geopolitical-impact-of-structural-economic-failings-in-egypt-tunisia-and-lebanon Misfortune to Marginalization: The Geopolitical Impact of Structural Economic Failings in Egypt,... Dec 4, 2025 - The food, energy, and debt crises in the Middle East and North Africa have exacerbated structural economic weaknesses of low- and middle-income... https://eric.ed.gov/?id=EJ795701 ERIC - EJ795701 - Talking to Foucault: Examining Marginalization and Exclusion in Academic Science,... In this article, the author invites everyone to join her as she follows Laurel Richardson's advice to use writing as a method of inquiry. To do so, she engages... https://noble.gs.washington.edu/papers/serang2010efficient.html Efficient marginalization to compute protein posterior probabilities from shotgun mass spectrometry... efficientmarginalizationcomputeprotein https://balkin.blogspot.com/2006/08/1-solution-and-marginalization-of.html?showComment=1156443600000 Balkinization: The 1% solution and the marginalization of civil liberties A group blog on constitutional law, theory, and politics balkinizationsolutionmarginalizationcivilliberties https://balkin.blogspot.com/2006/08/1-solution-and-marginalization-of.html?showComment=1156197120000 Balkinization: The 1% solution and the marginalization of civil liberties A group blog on constitutional law, theory, and politics balkinizationsolutionmarginalizationcivilliberties https://carnegieendowment.org/europe/research/2024/01/misfortune-to-marginalization-the-geopolitical-impact-of-structural-economic-failings-in-egypt-tunisia-and-lebanon Misfortune to Marginalization: The Geopolitical Impact of Structural Economic Failings in Egypt,... Dec 4, 2025 - The food, energy, and debt crises in the Middle East and North Africa have exacerbated structural economic weaknesses of low- and middle-income... https://meetings.aps.org/Meeting/APR24/Session/M13.3 APS -2024 APS April Meeting - Event - Gravitational wave inference with marginalization over... april meetinggravitational waveapsevent https://nij.ojp.gov/library/publications/changes-gender-gap-crime-and-womens-economic-marginalization Changes in the Gender Gap in Crime and Women's Economic Marginalization | National Institute of... This chapter reviews research on changes over time in the relative crime of women and men. https://researchportalplus.anu.edu.au/en/publications/place-personhood-and-marginalization-ontology-and-community-in-re/fingerprints/ Place, personhood and marginalization: Ontology and community in remote desert Australia -... placepersonhoodmarginalizationontologycommunity https://utahchildrenswriters.blogspot.com/2013/02/the-marginalization-of-writing.html Utah Children's Writers: The Marginalization of Writing by Scott Rhoades Yesterday as I was chatting with my friend and fellow writer Cliff at a cafe in San Francisco, the subject turned, as it ... utahchildrenwritersmarginalizationwriting https://scholars.uky.edu/en/projects/anti-haitianism-in-paradise-marginalization-stigma-and-antiblackn/ Anti-Haitianism in Paradise: Marginalization, Stigma and Antiblackness in the Bahamas - University... in paradisethe bahamasantimarginalization https://drum.lib.umd.edu/items/3c55cf45-81c4-4280-80fc-50ee7cc87e7a Beyond Diversity As Usual: Expanding Critical Cultural Approaches to Marginalization in Engineering... In general, what we think of as "diversity work" in undergraduate engineering education focuses in the following ways: more on the overlooked assets of... as usual https://researchportalplus.anu.edu.au/en/publications/lizards-of-the-lost-arcs-mid-cenozoic-diversification-persistence/fingerprints/ Lizards of the lost arcs: Mid-Cenozoic diversification, persistence and ecological marginalization... of the https://balkin.blogspot.com/2006/08/1-solution-and-marginalization-of.html?showComment=1156206000000 Balkinization: The 1% solution and the marginalization of civil liberties A group blog on constitutional law, theory, and politics balkinizationsolutionmarginalizationcivilliberties https://balkin.blogspot.com/2006/08/1-solution-and-marginalization-of.html?showComment=1156276680000 Balkinization: The 1% solution and the marginalization of civil liberties A group blog on constitutional law, theory, and politics balkinizationsolutionmarginalizationcivilliberties https://www.bu.edu/gdp/2021/04/27/towards-the-marginalization-of-multilateral-crisis-finance-the-global-financial-safety-net-and-covid-19/ Towards the Marginalization of Multilateral Crisis Finance? The Global Financial Safety Net and... financial safety net https://balkin.blogspot.com/2006/08/1-solution-and-marginalization-of.html?showComment=1442228569229 Balkinization: The 1% solution and the marginalization of civil liberties A group blog on constitutional law, theory, and politics balkinizationsolutionmarginalizationcivilliberties https://scholarworks.gsu.edu/items/f2918ae3-08fa-4e83-a5a5-6f885c24739d Deadly Viper Character Assassins: Cyber Discourse on Asian American Marginalization and Identity This study examines how Asian Americans articulate their marginalization and identity, as well as other issues related to race, through the use of blogs.... https://www.fsa.uni-heidelberg.de/en/newsroom/negotiating-marginalization-and-belonging Negotiating Marginalization and Belonging - Research Centre on Antigypsyism research centrenegotiatingmarginalizationbelongingantigypsyism https://humanrights.fhi.duke.edu/event/human-rights-practice-marginalization-and-human-rights-10-21-2025/ Human Rights in Practice: Marginalization and Human Rights | Duke Human Rights Center at the... Human Rights in Practice: Marginalization and Human Rights human rightsin practiceduke centermarginalization https://researchconnect.buffalo.edu/en/publications/social-isolation-and-social-marginalization/ Social Isolation and Social Marginalization - SUNY University at Buffalo social isolationmarginalizationsunyuniversitybuffalo https://balkin.blogspot.com/2006/08/1-solution-and-marginalization-of.html?showComment=1156180140000 Balkinization: The 1% solution and the marginalization of civil liberties A group blog on constitutional law, theory, and politics balkinizationsolutionmarginalizationcivilliberties https://grady.uga.edu/research/open-science-closed-doors-countering-marginalization-through-an-agenda-for-ethical-inclusive-research-in-communication/ Open science, closed doors? Countering marginalization through an agenda for ethical, inclusive... Sep 18, 2023 - Abstract: The open science (OS) movement has advocated for increased transparency in certain aspects of research. Communication is taking its first steps... open scienceclosed doors https://researchportalplus.anu.edu.au/en/publications/physical-approach-to-the-marginalization-of-ligo-calibration-unce/ Physical approach to the marginalization of LIGO calibration uncertainties - The Australian... to thephysicalapproachmarginalizationligo https://balkin.blogspot.com/2006/08/1-solution-and-marginalization-of.html?showComment=1156178940000 Balkinization: The 1% solution and the marginalization of civil liberties A group blog on constitutional law, theory, and politics balkinizationsolutionmarginalizationcivilliberties https://experts.umn.edu/en/publications/what-to-expect-kilonova-light-curve-predictions-via-equation-of-s/ What to Expect: Kilonova Light Curve Predictions via Equation of State Marginalization -... what to expectequation of state