Robuta

https://www.melksham-tyres.co.uk/tyre/details/giti/winterpro2-sport-suv Giti Winterpro2 Sport Suv Tyres in Melksham Giti Winterpro2 Sport Suv tyres with online booking for next day fitting by Doodles Tyres Limited in Melksham suv tyresgitisportmelksham https://melkshamnews.com/over-100-houses-planned-for-sandridge-common/ Over 100 houses planned for Sandridge Common - Melksham Independent News Jul 15, 2015 - A COMMUNITY consultation was held this week to gather feedback on a proposal for 110 new houses to be built near housesplannedsandridgecommonmelksham https://www.melksham-tc.gov.uk/whats-on/events/listings/family-film-sen/ Free Family Film (SEN) | Melksham Town Council family filmfreesenmelkshamtown https://melksham.info/about.html Melksham Environment Group melkshamenvironmentgroup https://directory.johnogroatspages.co.uk/company/613906654035968 Evana Designs 8 St Athan Close, Bowerhill, Melksham, Wiltshire, SN12 6XP | JohnogroatsPages Evana Designs 8 St Athan Close, Bowerhill, Melksham, Wiltshire, SN12 6XP https://www.spittingpig.co.uk/hog-roast-melksham/ Hog Roast Melksham - Spitting Pig Dec 16, 2025 - Are you hosting a party in this Wiltshire town on the Rover Avon? Do you need some expert assistance with the catering to make sure all of your guests receive... hogroastmelkshamspittingpig https://grahamellis.uk/blog1207.html Graham Ellis: Sustainable Energy in Melksham sustainable energygrahamellismelksham https://www.melksham-tyres.co.uk/tyre/details/budget/sport Budget Sport Tyres in Melksham Budget Sport tyres with online booking for next day fitting by Doodles Tyres Limited in Melksham sport tyresbudgetmelksham https://www.dicklovettmelkshammini.co.uk/finance/finance-calculator/national/27e63aae-2b28-441d-8b07-fdac2eb4e04a/ Dick Lovett Melksham | Authorised MINI Retailer Get the MINI you want, with our excellent finance and lease deals, brought to you by Dick Lovett Melksham. Visit or call us on 0122 556 0167 today. dicklovettmelkshamauthorisedmini https://www.areyoudancing.com/dance-event/797118/ AreYouDancing Melksham Sequence Dance Club Dance in Melksham Wiltshire Partner Dance Listing Website dance clubmelkshamsequencewiltshire https://www.melksham-tc.gov.uk/your-council/council-strategy/ Our Town Plan | Melksham Town Council our townplanmelkshamcouncil https://www.firstofficehub.com/en-gb/office-locations/united-kingdom/melksham Rent office space in Melksham | First Office Hub First Office Hub provides you access to rent flexible offices in Melksham. Take a look at the locations in United Kingdom where we have office spaces available... rent office spacemelkshamfirsthub https://melkshamnews.com/new-car-dealership-proposed-for-bowerhill/ New car dealership proposed for Bowerhill - Melksham Independent News Jan 4, 2019 - A PLANNING application has been made to build a new BMW and MINI car dealership on land at the intersection of new car dealershipproposedmelkshamindependentnews https://www.melkshamtownfc.net/events/a-frome-town-vs-melksham-town/form Registration Form | Melksham Town registration formmelkshamtown https://www.melkshamtownfc.net/events/h-melksham-town-vs-willand-rovers-2/form Registration Form | Melksham Town registration formmelkshamtown https://melkshamrecyclingandskipltd.co.uk/about-us/ Man With A Van Rubbish Removal in Melksham Call 07757 131158 Feb 2, 2026 - Fast, reliable man and van rubbish removal in Melksham and nearby towns. Furniture, garden waste, full clearances. Call 07757 131158 for a free quote. man with a vanrubbish removal https://www.psychologytoday.com/gb/counselling/eng/melksham?category=couples-counselling Find Couples Counselling and Therapists in Melksham, England - Psychology Today Find the Right Couples Counselling in Melksham, England - Kathryn Dugdale, MBACP; Rachael Blackmore, MBACP; Sheila Field, MA, MUKCP; OpenMind; Andy Meads, MA,... couples counsellingfindtherapistsmelkshamengland https://www.melkshamwithout-pc.gov.uk/index.php?page=assoc_docs&meeting=931&from=dates&date=2026-03-16&fldr=assets/Planning%2016th%20March%202026 Melksham Without Parish Council Melksham Without Parish Council melkshamwithoutparishcouncil https://www.pubsgalore.co.uk/pubs/66730/ The Kings Arms in Melksham : Pubs Galore the kings armsmelkshampubsgalore https://www.melkshamfoodandriverfestival.co.uk/sponsors Melksham Food and River Festival - Our Sponsors See who's sponsoring the Melksham Food and River Festival in 2025 food andriver festivalmelkshamsponsors https://melkshamnews.com/tag/894/ 894 Archives - Melksham Independent News Southern League South Sat. 27th September: Melksham Town 5-1 Falmouth Mon 29th September: Town 1-3 Didcot Town On the pitch, archivesmelkshamindependentnews https://melkshamnews.com/science-week-at-the-manor-school/ Science week at The Manor School - Melksham Independent News Mar 1, 2023 - MANOR School pupils have spent a week being scientists as the team from the The Festival of Tomorrow visited the science weekat themanorschoolmelksham https://www.wellho.info/mouth/3362_Swindon-Chippenham-and-Melksham-to-Weymouth-Sunday-Train-Service-Starts.html Swindon, Chippenham and Melksham to Weymouth - Sunday Train Service Starts Swindon, Chippenham and Melksham to Weymouth - Sunday Train Service Starts train serviceswindonchippenhammelkshamweymouth https://melkshamnews.com/give-cricket-a-spin-5/ Give cricket a spin! - Melksham Independent News Feb 26, 2020 - Whitley Cricket Club is encouraging players old and new to pick up their bat and ball and get back into givecricketspinmelkshamindependent https://grahamellis.uk/blog1557.html Graham Ellis: Melksham Splashpad for 2025 grahamellismelkshamsplashpad https://www.applebyandtownend.co.uk/ Appleby & Townend Estate Agents in Seend, Melksham Welcome to Appleby and Townend Estate Agents in Seend, a brand new Agency covering Melksham, Bradford-On-Avon, Corsham, Calne, Trowbridge and surrounding... estate agentsapplebymelksham https://melkshamnews.com/melksham-cat-rescue-charity-seeks-more-support-after-dramatic-increase-in-costs/ Melksham cat rescue charity seeks more support after dramatic increase in costs - Melksham... Nov 18, 2014 - THE newly-elected chair of a Melksham animal welfare charity has promised a fresh focus on fundraising after a dramatic increase cat rescuemore support https://melksham.info/brochure.html Melksham Environment Group melkshamenvironmentgroup https://melkshamnews.com/melksham-probus-club-2/ Melksham Probus Club - Melksham Independent News Aug 16, 2017 - MELKSHAM Probus Club held their monthly lunch at the Kings Arms Hotel on Tuesday 1st August. The after-lunch speaker was Mr melkshamprobusclubindependentnews https://www.melkshamneighbourhoodplan.org/siteallocation-topicpaper-appendicies Site Allocations Topic Paper Appendicies | Joint Melksham Plan siteallocationstopicpaperappendicies https://thermoplasticplaygroundmarkings.uk/sectors/thermoplastic-markings-for-parks-and-public-spaces/wiltshire/melksham Thermoplastic Markings for Parks and Public Spaces in Melksham | Public Park Playground Markings Our company installs thermoplastic markings for parks and public spaces in Melksham, offering safe, long-lasting solutions for playgrounds, walkways, and... parks and public spacesthermoplastic markings https://www.machineseeker-india.com/Haendler/121069/uk-food-machinery-ltd-melksham UK Food Machinery Ltd - used machines in Melksham uk foodused machinesmachineryltdmelksham https://www.melksham-tyres.co.uk/content/promotional/79587/2026+terms+and+conditions+for+10+and+30+off Melksham Tyres - 2026 Terms and Conditions for 10 and 30 off Doodles Tyres Limited - 2026 Terms and Conditions for 10 and 30 off terms and conditionsmelkshamtyres https://melkshamwithout-pc.gov.uk/ Melksham Without Parish Council Melksham Without Parish Council melkshamwithoutparishcouncil https://www.melksham-tyres.co.uk/tyre/details/gt-radial/maxmiler-allseason2 GT Radial Maxmiler Allseason2 Tyres in Melksham GT Radial Maxmiler Allseason2 tyres with online booking for next day fitting by Doodles Tyres Limited in Melksham gt radialtyresmelksham https://melkshamnews.com/business-as-usual-at-the-beeches-veterinary-centre/ Business as usual at the Beeches Veterinary Centre - Melksham Independent News Jun 6, 2018 - CHANGES are afoot at the Beeches Veterinary Centre with the departure of much-loved vet and clinical director, Trevor Warner - but business as usualat the https://mrug.org.uk/gettingthere.html Melksham Transport Users Group - where is the station? users groupwhere ismelkshamtransportstation https://visit-melksham.com/ Melksham Tourist Information Centre tourist informationmelkshamcentre https://melkshamnews.com/new-app-makes-reporting-issues-to-wiltshire-council-easier-than-ever/ New app makes reporting issues to Wiltshire Council easier than ever - Melksham Independent News Oct 26, 2021 - WILTSHIRE Council have launched a new app designed to make reporting any issues you may have easier than ever. The https://melkshamnews.com/melksham-family-of-churches-4/ Melksham Family of Churches - Melksham Independent News Jun 20, 2018 - As you may know, every year, Melksham Town Council awards grants to organisations, in order to bring real improvements to family of churchesmelkshamindependentnews https://www.melksham-tyres.co.uk/tyre/details/michelin/primacy-3-(zero-pressure) Michelin Primacy 3 (Zero Pressure) Tyres in Melksham Michelin Primacy 3 (Zero Pressure) tyres with online booking for next day fitting by Doodles Tyres Limited in Melksham michelin primacyzeropressuretyresmelksham https://melkshamnews.com/abc-nursery-packs-operation-christmas-child-boxes/ ABC Nursery packs Operation Christmas Child boxes - Melksham Independent News Nov 16, 2016 - Abc Day Nursery Pre- School have asked parents and staff to donate toys and clothes to create special gift boxes operation christmas childabcnurserypacksboxes https://melkshamnews.com/survey-to-improve-melksham-town-centre/ Survey to improve Melksham town centre - Melksham Independent News Oct 22, 2014 - The Melksham Town Team is carrying out a survey of customers and users of the town centre to help to town centresurveyimprovemelkshamindependent https://melkshamnews.com/cooking-demonstration-by-neff-home-economist-2/ Cooking demonstration by Neff home economist - Melksham Independent News Mar 27, 2019 - Have you been thinking about buying a new induction hob, combination steam oven or multifunction oven? Perhaps you already have cooking demonstrationneffeconomistmelkshamindependent https://parkyoga.co/melksham/ Park Yoga Melksham - Park Yoga Melksham: King George V Playing Field Where? Join our FREE Park Yoga sessions at King George V Playing Field, Lowbourne, SN12 7ED. Please look out for the... park yogamelksham https://melkshamnews.com/royal-british-legion-seend-to-mark-armed-forces-day-2/ Royal British Legion Seend to mark Armed Forces Day - Melksham Independent News Jun 6, 2018 - Armed Forces Day will be celebrated by the Seend branch of the Royal British Legion On Sunday 1st July, with royal british legionarmed forces day https://scratchingpost.co.uk/wiltshire/melksham/ Melksham Recruitment Agency | SP Recruitment recruitment agencymelkshamsp https://www.melksham-tc.gov.uk/download/operations-manager-jds/ Operations Manager JDS | Melksham Town Council operations managerjdsmelkshamtowncouncil https://melkshamwithout-pc.gov.uk/index.php?page=news&id=638 Melksham Without Parish Council Melksham Without Parish Council melkshamwithoutparishcouncil https://www.melkshamtownfc.net/events/h-melksham-town-v-basingstoke-town/form Registration Form | Melksham Town registration formmelkshamtown https://www.kwuk.com/property/sangster-avenue-melksham-sn12/ Sangster Avenue, Melksham, SN12 - Keller Williams Estate Agent Mar 17, 2026 - Newly refurbished, three double bedroom family home on Sangster Avenue, within walking distance of the local primary school and the town centre. The property... keller williamsavenuemelkshamestateagent https://townmaps.history.ac.uk/townmap/wiltshire-melksham-1836-2/ Wiltshire-Melksham-1836 - Catalogue of British Town Maps wiltshiremelkshamcataloguebritishtown https://melkshamnews.com/outrage-at-general-election-vandalism/ Outrage at General Election vandalism - Melksham Independent News Dec 4, 2019 - VANDALS have caused damage to several properties in the area in attacks that seem linked to the upcoming General Election. general electionoutragevandalismmelkshamindependent https://applebyandtownend.co.uk/ Appleby & Townend Estate Agents in Seend, Melksham Welcome to Appleby and Townend Estate Agents in Seend, a brand new Agency covering Melksham, Bradford-On-Avon, Corsham, Calne, Trowbridge and surrounding... estate agentsapplebymelksham https://melkshamnews.com/mike-smith-big-band-at-the-assembly-hall-3/ Mike Smith Big Band at the Assembly Hall - Melksham Independent News Dec 6, 2017 - THE Mike Smith Big Band are back at Melksham Assembly Hall on Saturday 30th December to raise money for the mike smithbig bandat theassembly hall https://www.wiltshire-opc.org.uk/document/melksham-birth-certificate-of-joyce-emily-coombe-1904/ Melksham - Birth Certificate of Joyce Emily Coombe 1904 - Wiltshire OPC Project birth certificatemelkshamjoyce https://melkshamnews.com/new-acts-announced-for-party-in-the-park-2/ New acts announced for Party in the Park - Melksham Independent News May 9, 2018 - MELKSHAM Party in the Park has announced two new acts confirmed for the event on Saturday 21st July, The Sultans party in the parknew actsannounced https://kiallafoods.com.au/amy-melksham-logo/ Amy-Melksham-Logo | Kialla Pure Foods amymelkshamlogopurefoods https://melkshamnews.com/raise-funds-for-cancer-care-with-upcoming-chocolate-bingo-evening/ Raise funds for cancer care with upcoming chocolate bingo evening - Melksham Independent News Mar 13, 2024 - A CHOCOLATE bingo evening, organised by Melksham Sparklers social group, is being held to raise funds for the RUHX and https://state.com/united-kingdom/councillors/councillor-jennie-westbrook-e05016253 Jennie Westbrook - Melksham Forest Councillor | State Jennie Westbrook is a Liberal Democrats councillor for Melksham Forest ward in Wiltshire. jenniewestbrookmelkshamforestcouncillor https://www.melksham-tyres.co.uk/tyre/brand/1323/toyo-tyres Toyo tyres in Melksham from Doodles Tyres Limited Toyo tyres available to book online for next day fitting by Doodles Tyres Limited in Melksham toyo tyresmelkshamdoodleslimited https://melkshamnews.com/melksham-band-nominated-for-best-soundtrack-award/ Melksham band nominated for Best Soundtrack Award - Melksham Independent News Aug 12, 2015 - MELKSHAM band, Thought Forms recently performed the track 'Out' on the 'Ex Machina' film soundtrack, composed by Geof Barrow and best soundtrackmelkshambandnominatedaward https://www.auto-torque.co.uk/ Used Cars Melksham, Wiltshire | Auto Torque Used cars for sale in Melksham, Wiltshire from Auto Torque. Visit our showroom or give one of our knowledgeable staff a call for more information on our range... used carsmelkshamwiltshireautotorque https://melkshamrecyclingandskipltd.co.uk/ House Clearance, Skips & Storage in Melksham Call 07757 131158 Jan 30, 2026 - Trusted family-run waste clearance, skips, storage and recycling in Melksham and surrounding areas. Up to 96% recycled. Call 07757 131158 for a fast, free... house clearanceskipsstoragemelkshamcall https://app.melksham-pharmacy.co.uk/services/travel-advice/11859850-5002-11f0-b9ea-cd44a2e2ed75 K & K Patel Ltd ta Melksham Pharmacy | Book a Pharmacy Appointment Book same day appointments at pharmacies near to you, including Pharmacy First and last minute Travel Vaccines. book apatelltdtamelksham https://www.dicklovettmelkshammini.co.uk/finance/insurance-solutions/electric-cover/ Electric Car Insurance in Melksham | Dick Lovett Melksham MINI Cover your MINI EV with electric insurance at Dick Lovett Melksham. Enquire now. electric car insurancemelkshamdicklovettmini https://www.theturnpikegarage.co.uk/service/page/battery-replacement Battery Replacement at The Turnpike Garage Melksham Battery Replacement - The Turnpike Garage in Melksham. battery replacementturnpikegaragemelksham https://melkshamnews.com/blooming-marvellous-melksham-in-bloom-winners-announced/ Blooming marvellous! Melksham in Bloom winners announced - Melksham Independent News Jul 27, 2016 - Melksham in Bloom winner Bruce Petty FOR the sixth year running, gardening enthusiast Bruce Petty has been named as the blooming marvellouswinners announcedmelkshamindependentnews https://themotcentremelksham.co.uk/home/garageonthehill1/ GarageOnTheHill1 - The MOT Centre Melksham mot centremelksham https://melkshamnews.com/top-ten-places-for-local-racers/ Top ten places for local racers - Melksham Independent News Apr 19, 2016 - The second round of the N G Road Racing championships at Cadwell Park took place last weekend. Broughton Gifford sidecar top tenplaceslocalracersmelksham https://melkshamnews.com/local-engineer-turns-handyman/ Local engineer turns handyman! - Melksham Independent News Oct 24, 2018 - LOCAL DIY and handyman, Steve Savage, says nothing is too much trouble and offers to help you with anything from localengineerturnshandymanmelksham https://melkshamnews.com/community-transport-stalwart-steps-down-after-25-years/ Community transport stalwart steps down after 25 years - Melksham Independent News Dec 17, 2023 - A LONG-standing volunteer and driving force of the charity, Melksham Area Community Transport (MACT), is stepping down after 25 years. community transportstalwartsteps https://www.theturnpikegarage.co.uk/tyre/brand/4/bridgestone BRIDGESTONE tyres from The Turnpike Garage Melksham BRIDGESTONE tyres available to book online for fitting at The Turnpike Garage in Melksham bridgestone tyresfrom theturnpikegaragemelksham https://www.melksham-tyres.co.uk/tyre/details/michelin/primacy-3 Michelin Primacy 3 Tyres in Melksham Michelin Primacy 3 tyres with online booking for next day fitting by Doodles Tyres Limited in Melksham michelin primacytyresmelksham https://www.melksham-tyres.co.uk/services/details/47/free-wheel-alignment-check Wheel Alignment Check from Doodles Tyres Limited in Melksham Wheel Alignment Check available at Doodles Tyres Limited in Melksham wheel alignmentcheckdoodlestyreslimited https://melkshamnews.com/morrisons-convenience-store-and-new-pub-planned-for-east-melksham/ Morrisons convenience store and new pub planned for East Melksham - Melksham Independent News Dec 4, 2013 - A NEW Morrisons convenience store and a family pub restaurant is proposed on a site to the east of the convenience store https://melkshamnews.com/town-to-fly-flag-for-commonwealth-day/ Town to fly flag for Commonwealth Day - Melksham Independent News Mar 1, 2017 - Melksham Town Council will be raising the Commonwealth flag at 10am on Monday 13th March to celebrate Commonwealth Day. This commonwealth daytownflyflagmelksham https://www.minetyrfc.com/fixture/f77878d8-e699-411c-ad6b-515834a7061b Melksham III-Minety II Melksham III-Minety II melkshamiii https://www.melksham-tyres.co.uk/ Doodles Tyres Limited | Melksham Tyres Doodles Tyres Limited supply and fit tyres in store and offer a mobile tyre fitting service for Melksham. Tyres near me. Melksham Tyres doodlestyreslimitedmelksham https://melkshamnews.com/melksham-celebrates-world-book%E2%80%88day/ Melksham celebrates World Book Day - Melksham Independent News Mar 11, 2020 - SCHOOLS across Melksham celebrated World Book Day last week with pupils (and staff) dressing up as their favourite book characters to world book daymelkshamcelebratesindependentnews https://melkshamnews.com/tag/netball/ netball Archives - Melksham Independent News AT the end of a hot summer season Melksham Netball Team took part in a fancy dress charity netball match netballarchivesmelkshamindependentnews https://melkshamnews.com/anger-as-trees-felled-the-day-before-south-west-in-bloom-judging/ Anger as trees felled the day before South West in Bloom judging - Melksham Independent News Aug 2, 2017 - The tree is cut down. VOLUNTEERS in Melksham were left reeling in disbelief after trees in the Market Place were https://melkshamwithout-pc.gov.uk/index.php?page=minutes&year=2022 Melksham Without Parish Council Melksham Without Parish Council melkshamwithoutparishcouncil https://timberframeinsulation.co.uk/near-me/wiltshire-melksham/ Timber Frame Insulation in Melksham Timber frame insulation offers in Melksham SN12 6 thermal performance for framed walls using high-quality insulation materials designed to suit timber frame... timber frameinsulationmelksham https://electric-vehicle-charger-installation.co.uk/near-me/wiltshire-melksham/ Electric Charger Installation in Melksham SN12 6 for Home Electric Vehicles Get Electric charger installation service in Melksham [zip at home with approved systems. Ideal for electric vehicles, charging solutions, and electric car use... charger installationfor homeelectricmelkshamvehicles https://www.melksham-tc.gov.uk/whats-on/events/listings/us-girls-july-1/ US Girls | Melksham Town Council us girlsmelkshamtowncouncil https://melkshamnews.com/festive-fundraiser-at-sarum-avenue-in-full-swing/ Festive fundraiser at Sarum Avenue in full swing - Melksham Independent News Dec 11, 2024 - The Sarum Avenue Christmas lights display is in full swing after TV antiques star Paul Martin took the honours of in fullfestivefundraiseravenue https://www.mmstrainingacademy.co.uk/ Melksham Motor Spares Training Academy (MMSTA) Melksham Motor Spares, leading independent distributor of quality automotive parts and accessories in Wiltshire, Somerset and the surrounding areas. training academymelkshammotorspares https://nationaltelehandlerhire.co.uk/near-me/wiltshire-melksham/ National Telehandler Hire in Melksham National telehandler hire in Melksham SN12 6 with a wide range of telehandlers, plant equipment, and fast delivery for all industrial site needs. telehandler hirenationalmelksham https://www.melkshamneighbourhoodplan.org/neighbourhood-plan-1 Neighbourhood Plan 1 | Joint Melksham Plan neighbourhood planjointmelksham https://melkshamnews.com/councils-unite-in-opposition-to-more-houses-and-care-home-plans/ Councils unite in opposition to more houses and care home plans - Melksham Independent News Jan 18, 2023 - A PLANNING application has received objections by parish and town councillors, for 210 residential dwellings and a care home to https://melkshamdentalpractice.com/pricelist/ Prices | Melksham Dental Practice pricesmelkshamdentalpractice https://pinkuk.com/events/europe/uk/wiltshire/melksham/melksham-pride-festival-2024 Melksham Pride Festival 2024 Melksham Pride Festival 2024 Melksham Pride takes place on Saturday the 29th June 2024. Proud Melksham is an LGBT+ Hub for the town of [...] pride festivalmelksham https://melkshamnews.com/foreign-secretary-dominic-raab-visits-melksham/ Foreign Secretary, Dominic Raab, visits Melksham - Melksham Independent News Oct 23, 2019 - LOCAL MP Michelle Donelan hosted a visit from the Foreign Secretary, Dominic Raab, in his first visit to Melksham where foreign secretarydominic raabvisitsmelkshamindependent https://melkshamwithout-pc.gov.uk/?page=news&news_search=&count=13 Melksham Without Parish Council Melksham Without Parish Council melkshamwithoutparishcouncil https://melksham-pharmacy.co.uk/ Melksham Pharmacy melkshampharmacy https://melkshamrecyclingandskipltd.co.uk/house-garden/ House & Garden Clearance in Melksham Call 07757 131158 Feb 2, 2026 - Professional house and garden clearance across Melksham and nearby villages. Licensed, eco-friendly and stress-free. Call 07757 131158 today. house gardenclearancemelkshamcall https://www.dicklovettmelkshammini.co.uk/finance/finance-calculator/national/b5664797-9e9f-4f2e-ae40-649a56f649c6/ Dick Lovett Melksham | Authorised MINI Retailer Get the MINI you want, with our excellent finance and lease deals, brought to you by Dick Lovett Melksham. Visit or call us on 0122 556 0167 today. dicklovettmelkshamauthorisedmini https://melkshamnews.com/phab-club-leader-gets-fond-farewell-with-lifetime-achievement-award/ Phab club leader gets fond farewell with lifetime achievement award - Melksham Independent News Feb 12, 2025 - Melksham Phab Club held a celebration party recently to mark the retirement of its leader, Dawn Gough, who was presented lifetime achievement award https://website-development-and-design.co.uk/search-engine-optimisation/wiltshire/melksham Search Engine Optimisation in Melksham | SEO Company If you have recently launched your new business website and you are looking to get enquiries, you may want to get in touch with our SEO experts in Melksham who... search engine optimisationmelkshamseocompany