Robuta

https://www.knowled.com/ GODOX Photo Equipment Co.,Ltd. Founded in 1993 as a high-tech manufacturing facility specializing in lighting and audio equipment, Godox has now become a lighting equipment expert and... photo equipmentgodoxcoltd https://www.remlimited.com/ Asset Management | London | Real Estate Management (UK) LTD The Complete Asset Management Service for London's Premier Real Estate asset managementreal estatelondonukltd https://www.carnivalcorp.com/ Carnival Corporation Ltd. carnival corporationltd https://ukznextendedlearning.com/ Home - UKZN Extended Learning (Pty) Ltd extended learningukznptyltd https://www.master-d.com.sg/ Master D'Imaging Pte Ltd. Master D'Imaging Pte Ltd. pte ltdmasterimaging https://www.webfactoryltd.com/ WebFactory Ltd - The WordPress Specialists Nov 18, 2021 - Love WordPress? We do too! That's why we create all our products and projects with it. Visit to find out more about our WordPress journey. webfactory ltdwordpress specialists https://www.44bytes.net/ 44 Bytes Ltd - Intelligent Internet Services internet servicesbytesltdintelligent https://www.protec.co.uk/ Protec Fire and Security Group Ltd | Industry Leading fire and securityindustry leadingprotecgroupltd https://www.olimex.com/ OLIMEX LTD - OLinuXino Arduino Maple Pinguino ARM Open Source Hardware Development Boards OLIMEX Open Source Hardware Development Boards open source hardwaredevelopment boardsolimexltdolinuxino https://webtoonscorp.com/ NAVER WEBTOON Ltd. naver webtoonltd https://www.apexltl.com/ Apex Motor Express Ltd. - We care - Home apex motor expresswe careltd https://www.nintendo.co.jp/sustainability/en-us/index.html Sustainability | Nintendo Co., Ltd. The Sustainability page of Nintendo Co., Ltd. sustainabilitynintendocoltd https://www.gamblingcommission.gov.uk/public-register/business/detail/60629 Tek Fox Ltd - Licence summary Licences and activities held by Tek Fox Ltd tek fox ltdlicence summary https://www.lucasfilm.com/ Lucasfilm Ltd. | Lucasfilm.com Sep 3, 2026 - Founded in 1971, Lucasfilm is one of the world's leading entertainment companies and home to the legendary Star Wars and Indiana Jones franchises. lucasfilmltd https://orientalinsurance.org.in/ The Oriental Insurance Company Ltd. OICL - The Oriental Insurance Company Ltd oriental insurancecompany ltd https://www.gov.uk/employment-tribunal-decisions/a-mamcarz-v-synergy-consulting-engineers-ltd-6009472-slash-2024 A Mamcarz v Synergy Consulting Engineers Ltd: 6009472/2024 - GOV.UK Employment Tribunal decision. consulting engineersgov uksynergyltd https://www.smarthub.com.sg/index.html Smarthub Solutions Pte Ltd pte ltdsmarthubsolutions https://www.roboticstomorrow.com/company_directory/thinkbi-tech-solution-pvt-ltd/13507 Industrial Automation, Robots and Unmanned Vehicles Company - ThinkBI Tech Solution Pvt. Ltd |... Software Development Services Provider industrial automationunmanned vehiclestech solutionrobotscompany https://www.gov.uk/employment-tribunal-decisions/mr-b-k-pick-v-car-carrying-ltd-in-liquidation-and-secretary-of-state-for-business-energy-and-industrial-strategy-3201300-2018 Mr B K Pick and others v Car Carrying Ltd (in liquidation) and Secretary of State for Business... Employment Tribunal decision. secretary of stateand othersfor businessmrk https://www.y-yokohama.com/cp/global/motorsports/2015ms/grc/msg_15_grc_09_res/ 2015 Global Rallycross Round 9 Result | MOTORSPORTS | THE YOKOHAMA RUBBER CO., LTD. Welcome to Yokohama Rubber Official Web Site. This site provides Company Information, News Releases, and Shareholder and Investor Information and Introduces... yokohama rubberglobalrallycrossroundresult https://www.indiainfoline.com/company/prestige-estates-projects-ltd-share-price Prestige Estates Projects Ltd Stock Price: Prestige Estates Share Price Today | India Infoline Prestige Estates Projects Ltd Share Price Today: Get the live NSE/BSE Stock Price of Prestige Estates Projects Ltd with performance, market cap, financial... stock priceshare todayprestigeestatesprojects https://rooseveltroadre.com/ Roosevelt Road Re Ltd. rooseveltroadltd https://www.bellevuearchitects.com.au/index.php Bellevue Architects Pty. Ltd. Bellevue Architects Pty. Ltd.. Read more bellevuearchitectsptyltd https://www.gov.uk/employment-tribunal-decisions/mr-j-whewell-v-bowker-preston-ltd-2415195-2018 Mr J Whewell v Bowker Preston Ltd: 2415195/2018 - GOV.UK Employment Tribunal decision. gov ukmrjprestonltd https://www.tooltechplastics.com.au/ Plastic Injection Moulding | Tooltech Plastics Pty Ltd plastic injection mouldingplasticsptyltd https://sacred-incense.co.uk/ Sacred Incense Ltd - The finest Incenses from around the globe Incenses from around the world the finestsacredincenseltdaround https://www.flpropertyltd.co.uk/index.html F.L Property Maintenance ltd - UPVC, Tile roof, Slate, New roofs, Roofing services, Fascias,... F.L Property Maintenance ltd - UPVC, Tile roof, Slate, New roofs, Roofing services, Fascias, Soffits and Guttering replacement and repairs at competitive... property maintenancetile roofnew roofsroofing servicesltd https://www.gov.uk/employment-tribunal-decisions/mr-d-ruthven-v-ng-bailey-it-services-ltd-1811649-2018 Mr D Ruthven v NG Bailey IT Services Ltd: 1811649/2018 - GOV.UK Employment Tribunal decision. mr dit servicesgov ukngbailey https://www.gov.uk/employment-tribunal-decisions/mr-g-leckey-v-thorntons-ltd-2603050-slash-2021 Mr G Leckey v Thorntons Ltd: 2603050/2021 - GOV.UK Employment Tribunal decision. gov ukmrthorntonsltd https://stockhouse.com/companies/bullboard?symbol=iamuy PINL:IAMUY | Stock Discussion | India Cement Ltd (PK) Get stock insights, analysis and discussion about India Cement Ltd (PK) (PINL:IAMUY). Join the IAMUY discussion on Canada's largest online investor community stockdiscussionindiacementltd https://www.home.saxo/nb-no/markets/stocks/stne-xnas StoneCo Ltd aksje | Saxo Bank StoneCo Ltd is a provider of financial technology solutions. saxo bankltd https://www.irasia.com/listco/hk/hkbn/cpresent/22index.htm irasia.com - HKBN Ltd. ltd https://www.akeeba.com/support/desktop-utilities/3793-advice-needed-whats-the-best-way-to-run-remote-cli-on-a-windows-7-box.html UNiTE, Remote CLI, eXtract Wizard - Akeeba Ltd Akeeba Ltd is a provider of premium software for Joomla! and WordPress uniteremotecliextractwizard https://www.innofluid.com/index.html Peristaltic pump|Constant flow pump|Syringe Innofluid Co., Ltd. Innofluid Co., Ltd. Precision Pump Co., Ltd. is professional manufacturer for laboratory peristaltic pump, industrial peristaltic pump,pump and constant flow... peristaltic pumpconstant flowsyringeltd https://www.propertyguru.com.sg/agent/cerlyn-zhang-627564 Cerlyn Zhang, PROPNEX REALTY PTE. LTD., Singapore | Propertyguru.com.sg Property agent Cerlyn Zhang in Singapore. Find Cerlyn Zhang's profile, experience, transactions, reviews and active listings. Get Cerlyn Zhang's guidance for... pte ltdzhangrealtysingaporepropertyguru https://architizer.com/idea/4401299/ Idea 4401299: Nonthaburi House by MAKE IT POP Co., Ltd. in Nonthaburi, Thailand - Architizer Image from Nonthaburi House by MAKE IT POP Co., Ltd. in Nonthaburi, Thailand make it popin thailandideanonthaburihouse https://furm.com/trademarks/dyvalis-99799033 DYVALIS Trademark of Taizhou Gexi Technology Co., Ltd. - Serial Number 99799033 - Furm DYVALIS is a trademark owned by Taizhou Gexi Technology Co., Ltd. and filed on Friday, May 1, 2026 in the Environmental Control Instrument Products category. serial numbertrademarktaizhoutechnologyco https://upstox.com/stocks/sanmitra-commercial-ltd-share-price/ SANMITRA COMMERCIAL LTD. Share Price Today - Live ZSANMCOM Stock Price for NSE/BSE Get SANMITRA COMMERCIAL LTD. share price, market statistics, corporate action, fundamental and technical analysis at Upstox. Start investing in ZSANMCOM today! share pricetoday livecommercialltdstock https://www.pdf-xchange.com/knowledgebase/all/search?q=tag:anti PDF-XChange Co Ltd Knowledge Base :: Search results The Knowledge Base for PDF-XChange. Search the Knowledge Base for general help, browse FAQs, search the help article database to find the answers to your... knowledge base searchpdf xchangecoltdresults https://web.archive.org/all/20061107161648/http:/www.wildwaterrafting.com/employment.html Adventure Rafting with Wildwater Ltd., widely recognized as one of the finest whitewater rafting... Whitewater rafting on the Chattooga, Nantahala, Ocoee and Pigeon Rivers with Wildwater Ltd. 30 years of whitewater experience on Southeastern USA... widely recognizedas onethe finestadventurerafting https://www.canjing.net/ Shenzhen Canjing Electronics Co.,LTD Shenzhen Canjing Electronics Co.,LTD shenzhenelectronicscoltd https://shivamautotech.com/ Shivam Autotech LTD shivamautotechltd https://training.rudrasec.io/ Rudrasec pty Ltd ptyltd https://www.flipsnack.com/B8FEE5AA9F7/ordering-guide-2024.html Ordering Guide 2024 - Unbranded by Office Choice Ltd - Flipsnack Flipsnack is a digital catalog maker that makes it easy to create, publish and share html5 flipbooks. Upload a PDF or design from scratch flyers, magazines,... ordering guideunbrandedofficechoiceltd https://www.adsdf.co.uk/ ADSDF Architects Ltd | Lincolnshire | Nottinghamshire |Planning | Project management | Design |... We are Architects based in Lincolnshire. ADSDF Architects Ltd are a highly experienced team working at every stage. From concept, planning applications to... project managementarchitectsltdlincolnshirenottinghamshire https://propellerfuels.com/ Home | Propeller Fuels Ltd Delivering Quality Marine Fuels. Competitively Priced, Uniquely Serviced. Serving all the main ports across the United Kingdom, from numerous loading terminals... propellerfuelsltd https://roboforex.com/beginners/info/charts/stock_rst/veon/ NASDAQ:VEON stock price chart - VEON Ltd. - RoboForex Live VEON chart and quotes. VEON Ltd. is traded on NASDAQ. Bid 48.86 USD, ask 52.86 USD. Explore USA stocks and CFDs in 2026. stock price chartnasdaqveonltdroboforex https://www.bordernet.co.uk/ Web Site Design Scotland, UK - Bordernet Ltd Scotland web site designscotland ukltd https://www.blog.ess.pmms.org.uk/ Home - PMMS Ltd Jan 7, 2025 - PMMS provides the full range of managing agent and block management services for residential blocks across London and surrounding counties. pmmsltd https://www.indiainfoline.com/company/fone4-communications-india-ltd/results/quarterly-result Fone4 Communications (India) Ltd Quarterly Results | India Infoline Checkout Fone4 Communications (India) Ltd quarterly results, including sales, expenses, income, and past results, with one click on India Infoline quarterly resultscommunicationsindialtdinfoline https://www.nasdaq.com/market-activity/stocks/chowf/news-headlines Chow Sang Sang Holdings International Ltd. (CHOWF) News Headlines | Nasdaq Stay up-to-date on Chow Sang Sang Holdings International Ltd. (CHOWF) news with the latest updates, breaking headlines, news articles, and more from around the... news headlineschowsangholdingsinternational https://www.akeeba.com/support/site-restoration.html?task=main Site Restoration - Akeeba Ltd Akeeba Ltd is a provider of premium software for Joomla! and WordPress site restorationltd https://www.pmtexim.com/ PMT EXIM PVT LTD pmteximpvtltd https://bizidex.com/en/zealandimmigration Zealand Immigration Ltd - Consulting - Bizidex zealandimmigrationltdconsulting https://www.gov.uk/employment-tribunal-decisions/mr-s-ogrady-v-alpha-omega-property-maintenance-and-construction-ltd-1600377-slash-2023 Mr S O'Grady v Alpha Omega Property Maintenance and Construction Ltd: 1600377/2023 - GOV.UK Employment Tribunal decision. maintenance and constructionalpha omegagov ukmrgrady https://www.bikeradar.com/reviews/components/groupsets/cranksets/3t-torno-ltd-1x-aero-crankset-long-term-review 3T Torno LTD 1x aero crankset long term review May 23, 2019 - Does this divisive 1x aero carbon crankset live up to expectations? long termtornoltdaerocrankset https://www.nasdaq.com/market-activity/stocks/gulrf/press-releases Guoco Group Ltd. (GULRF) Press Releases | Nasdaq Get the latest insights on Guoco Group Ltd. (GULRF) with press releases and corporate news to help you in your trading and investing decisions. press releasesgroupltdnasdaq https://razorpay.com/ifsc-code/gujarat-state-co-operative-bank/gujarat/mendarda/the-junagadh-jilla-sahakari-bank-ltd-mendarda/GSCB0JND012/ IFSC Code For Gujarat State Co-operative Bank, The junagadh jilla sahakari bank ltd mendarda,... ifsc codegujaratstateoperativebank https://www.nanaimo.ca/business_report/bus_details.aspx?licence=131342 SUKH PLUMBING AND HEATING LTD | City of Nanaimo Business licence details for SUKH PLUMBING AND HEATING LTD, including address, phone number, business description, map views, and more... plumbing and heatingcity of nanaimoltd https://cmrtimbergroup.co.uk/ Home: Buy Top Quality Timber Products Online - CMR Timber Ltd May 14, 2026 - Explore the benefits of high quality timber for your projects and discover why it is the top choice for durability and aesthetics. top qualitytimber productsbuyonlinecmr https://www.gov.uk/employment-tribunal-decisions/mr-d-mcjannet-v-asig-ltd-3324303-2016 Mr D McJannet v Asig Ltd: 3324303/2016 - GOV.UK Employment Tribunal decision mr dgov ukltd https://www.newswire.com/news/sekur-private-data-ltd-announces-non-brokered-private-placement Sekur Private Data Ltd. Announces Non-Brokered Private Placement | Newswire private dataltdannouncesnonplacement https://www.gabilradio.com/index Home - Gabil Co., Ltd. coltd https://tripsbookmarks.com/story19812456/massimiliano-arena-building-wealth-with-obo-ltd Massimiliano Arena: Building Wealth with OBO Ltd building wealtharenaoboltd https://en.acompany.tech/ Acompany Co., Ltd. | Privacy Tech Company Acompany leverages security technologies centered on confidential computing, along with expertise in privacy and AI governance, to support data and AI... tech companyltdprivacy https://www.akeeba.com/support/admin-tools-wordpress/39014-timezone-problem-with-admintools-after-transfer-to-new-server-with-akeebabackup.html Admin Tools for WordPress - Akeeba Ltd Akeeba Ltd is a provider of premium software for Joomla! and WordPress admin tools for wordpressltd https://flokii.com/business-follower/elite-elevators-pvt-ltd-135404 Elite Elevators Pvt LTD - Home Inspection in Hubballi | Flokii "Home Elevators in Hubli- Elevate Your Luxury Home Elite Elevators is the leading provider of home elevators in Hubli, offering a perfect blend of luxury,... home inspectioneliteelevatorspvtltd https://www.londonistltd.com/ Londonist Media Kit - Londonist Ltd Advertising online with londonist.com reaches a highly engaged London audience. Native advertising, sponsored content, display advertising and email... media kitlondonistltd https://groww.in/stocks/gujarat-narmada-valley-fertilizers-chemicals-ltd Gujarat Narmada Valley Fertilizers & Chemicals Ltd Share Price, Stock Price, LIVE NSE/BSE - Groww share pricegujaratnarmadavalleyfertilizers https://www.gov.uk/employment-tribunal-decisions/ms-n-fernandes-v-clubify-ltd-2200906-slash-2021 Ms N Fernandes v Clubify Ltd: 2200906/2021 - GOV.UK Employment Tribunal decision. gov ukmsnltd https://simplywall.st/stocks/jp/consumer-durables/tse-8995/makoto-construction-coltd-shares/management Makoto Construction Co,Ltd (8995) Leadership & Management Team Analysis - Simply Wall St Learn about Makoto Construction Co,Ltd (8995) stock's management team. Comprehensive performance, salary and tenure analysis for the CEO, board and leadership... leadership managementteam analysiswall stmakotoconstruction https://panjiva.com/Far-East-Tableware-Ltd/194749122 Far East Tableware Ltd., RM 305C BLCOK 2 KOON WAH MIRROR FACTORY (6TH) INDUSTRIAL BLD TUEN MUN HK |... Far East Tableware Ltd. at RM 305C BLCOK 2 KOON WAH MIRROR FACTORY (6TH) INDUSTRIAL BLD TUEN MUN HK. Find their customers, contact information, and details on... far easttuen muntablewareltdrm https://bgp.tools/as/51825 AS51825 Telzar 019 International Telecommunications Services LTD - bgp.tools Telzar 019 International Telecommunications Services LTD (AS51825) is a small BGP network that is peering with 2 other networks and has 2 upstream carriers telecommunications servicesinternationalltdbgptools https://www.sofi.com/invest/stock/MALRY/ Buy MINERAL RES LTD UNSP/ADR by Mineral Resources Ltd. Stock - MALRY Stock Price, Quote & News |... See real time price charts for MALRY stock, historical data, and recent news. Buy MALRY stock online with no commission fees. by resourcesprice quotebuymineralltd https://informaconnect.com/tides/sponsors/tianjin-nankai-hecheng-st-coltd/ Nankai Heching S&T Co Ltd (Tianjin Nankai) | TIDES USA: Oligonucleotide & Peptide Therapeutics s tcoltdtianjintides https://alazizgroup.com/ Al Aziz Packaging & Printing Ltd. packaging printingalazizltd https://www.portico.org/publishers/modestum/?start_with=C Modestum Ltd - Portico ltdportico https://www.ig.com/ch/aktien/maerkte-aktien/toppan-printing-co-ltd-7911-JP Toppan Printing Co Ltd Aktien handeln | Toppan Printing Co Ltd Realtime Aktienkurs | IG Schweiz TOPPAN Holdings Inc is a Japan-based company engaged in the information and communication, lifestyle and industry, and electronics business. The... [CH] aktien handelnprintingcoltdrealtime https://www.payscale.com/research/AU/Job=Restaurant_Manager/Salary/56ec14cb/Hungry-Jacks-Pty-Ltd-Training Restaurant Manager with Training Skills Salary at Hungry Jack's Pty Ltd in Australia in 2026 |... The average salary for a Restaurant Manager with Training skills at Hungry Jack's Pty Ltd in Australia is AU$60,050 in 2026. Visit PayScale to research... restaurant managerin australiatrainingskillssalary https://www.indiainfoline.com/company/aditya-forge-ltd/cash-flow Aditya Forge Ltd Cash Flow Statement | India Infoline Stay updated on Aditya Forge Ltd financial performance with its Cash Flow Statement in a consolidated or standalone format at India Infoline cash flow statementadityaforgeltdindia https://iultd.org/ Home:: Illinois Urogynecology LTD illinoisurogynecologyltd https://www.businesstoday.in/stocks/advent-computer-services-ltd-share-price-362601 Advent Computer Services Ltd Share Price Today, Advent Computer Services Ltd Stock Price NSE, BSE Advent Computer Services Ltd Share price NSE, BSE today: check share/stock price of Advent Computer Services Ltd, get live NSE/BSE stock price of Advent... computer servicesshare priceadventltdtoday https://www.xing.com/profile/Dmitry_Varfolomeev Dmitry Varfolomeev - Chief Financial Officer (CFO) - Berezka Ltd | XING Dmitry Varfolomeev, Limassol Professional experience, contact details, portfolio, etc.: Find out more or get in touch with Dmitry Varfolomeev on XING. chief financial officerdmitrycfoltdxing https://www.rysun.co.in/ Home | Rysun IT Solutions Pvt Ltd it solutionspvtltd https://www.indiainfoline.com/company/ovobel-foods-ltd/results/quarterly-result Ovobel Foods Ltd Quarterly Results | India Infoline Checkout Ovobel Foods Ltd quarterly results, including sales, expenses, income, and past results, with one click on India Infoline quarterly resultsfoodsltdindiainfoline https://simplywall.st/stocks/cn/healthcare/szse-300760/shenzhen-mindray-bio-medical-electronics-shares/news/there-is-a-reason-shenzhen-mindray-bio-medical-electronics-c There Is A Reason Shenzhen Mindray Bio-Medical Electronics Co., Ltd.'s (SZSE:300760) Price Is... Shenzhen Mindray Bio-Medical Electronics Co., Ltd.'s ( SZSE:300760 ) price-to-earnings (or "P/E") ratio of 22.8x might... there ismedical electronicsreasonshenzhenmindray https://www.motilaloswal.com/share-market/remi-edelstahl-tubulars-ltd Remi Edelstahl Tubulars Ltd: Share Price Today - Live Updates | Motilal Oswal Remi Edelstahl Tubulars Ltd Share Price Today - Get latest Performance analysis and chart, shareholding pattern, technical analysis, financial and annual... share pricetoday livemotilal oswalremiedelstahl https://www.motilaloswal.com/share-market/pearl-global-industries-ltd Pearl Global Industries Ltd: Share Price Today - Live Updates | Motilal Oswal Pearl Global Industries Ltd Share Price Today - Get latest Performance analysis and chart, shareholding pattern, technical analysis, financial and annual... global industriesshare pricetoday livemotilal oswalpearl https://www.pdf-xchange.com/knowledgebase/350-How-do-I-submit-a-PDF-XChange-Editor-or-PDF-XChange-Viewer-SDK-Distribution-Declaration-document PDF-XChange Co Ltd :: Knowledge Base :: How do I submit a PDF-XChange Editor or PDF-XChange Viewer... KnowledgeBase :: How do I submit a PDF-XChange Editor or PDF-XChange Viewer SDK Distribution Declaration document? how do ipdf xchangeknowledge basecoltd https://www.finanstilsynet.no/en/investor-alerts/2021/td-market-investment-capital-ltd--tiandin-limited/ TD Market Investment Capital Ltd / Tiandin Limited - Finanstilsynet.no investment capitaltdmarketlimitedfinanstilsynet https://www.ezy-1.com/ EZY1 Pte Ltd - Your Journey Begins Here At EZY1, we value our client's interest. You are here to expect professional and efficient services. pte ltdyour journeybegins https://www.theconstructionindex.co.uk/company/Euro-Demolition-&-Dismantling-Ltd/43078 Euro Demolition & Dismantling Ltd - Marchington - Staffordshire - UK eurodemolitiondismantlingltdstaffordshire https://www.volvocars.com/fr-ca/media/press-releases/884127BE303BAD7B/ Volvo Car Canada Ltd. Reports July Sales Results | Volvo Cars Media FR CA Volvo Car Canada Ltd. reports sales results for July: a total of 1,055 vehicles were retailed throughout the month, for an increase of 20.6 percent over the... volvo carsales resultscanadaltdreports https://bouchesocial.com/story23633391/professional-person-and-van-solutions-in-london-by-que-elimination-ltd Professional person and Van solutions in London by Que elimination Ltd in londonprofessionalpersonvansolutions https://www.fca.org.uk/news/warnings/devicsonminersltd Devicsonminers.Ltd | FCA Jul 4, 2023 - Devicsonminers.Ltd is not authorised or registered by the FCA. Find out more about unauthorised firms and individuals. ltdfca https://brijindia.com/ Brij Systems Ltd systemsltd https://kufamba.com/ Kufamba Africa Ltd africaltd https://www.motilaloswal.com/share-market/iec-education-ltd IEC Education Ltd: Share Price Today - Live Updates | Motilal Oswal IEC Education Ltd Share Price Today - Get latest Performance analysis and chart, shareholding pattern, technical analysis, financial and annual report at... share pricetoday livemotilal oswalieceducation https://www.care.com/b/l/revive-a-rug-ltd/merrick-ny Revive-A-Rug Ltd - Care.com Merrick, NY House Cleaning Service Schedule an appointment today at Revive-A-Rug Ltd. house cleaning servicereviverugltdcare https://www.veloxgold.com/ Velox - Prem Gold Pvt Ltd veloxpremgoldpvtltd