Robuta

https://www.mayo.edu/research/labs/membrane-trafficking-disease Membrane Trafficking in Disease: Mark A. McNiven - Membrane Trafficking in Disease - Mayo Clinic... Mayo Clinic's Membrane Trafficking in Disease Lab studies membrane and cytoskeletal interactions essential to pancreas, lung and liver health. membrane traffickingdiseasemarkmcnivenmayo https://www.frontiersin.org/journals/plant-science/articles/10.3389/fpls.2015.00878/full Frontiers | Roles of membrane trafficking in plant cell wall dynamics The cell wall is one of the characteristic components of plant cells. The cell wall composition differs among cell types and is modified in response to vario... plant cell wallmembrane traffickingfrontiersrolesdynamics https://pmc.ncbi.nlm.nih.gov/articles/PMC6782463/ Membrane Trafficking Regulates the Activity of the Human Dopamine Transporter - PMC The trafficking of synaptic proteins is unquestionably a major determinant of the properties of synaptic transmission. Here, we present a detailed analysis of... membrane traffickingthe activitydopamine transporterhumanpmc https://www.wikidata.org/wiki/Q41016178 Membrane Trafficking of the Cystic Fibrosis Gene Product, Cystic Fibrosis Transmembrane Conductance... scientific article published on August 21, 1998 membrane traffickingof thecystic fibrosisgene producttransmembrane https://www.mdpi.com/1422-0067/25/5/2608 Myelin Basic Protein Attenuates Furin-Mediated Bri2 Cleavage and Postpones Its Membrane Trafficking Myelin basic protein (MBP) is the second most abundant protein in the central nervous system and is responsible for structural maintenance of the myelin sheath... myelin basic protein https://elifesciences.org/articles/53322 Structure and activation mechanism of the BBSome membrane protein trafficking complex | eLife Two cryo-EM structures of the mammalian BBSome show how the BBSome is recruited to membranes and activated by the GTPase ARL6 prior to binding transmembrane... of the