Robuta

https://jdrsoftware.com.au/patrick-pleass-memorial-award-2020/ Patrick Pleass Memorial Award 2020 | JDR Software memorial awardpatrickjdrsoftware https://www.asntr.org/bernard-sanberg-memorial-award.html Bernard Sanberg Memorial Award - THE AMERICAN SOCIETY FOR NEURAL THERAPY AND REPAIR The Bernard Sanberg Memorial Award will be presented by the ASNTR to an individual on the basis of outstanding research contributions in the field of neural... memorial awardthe american https://www.efx.co.uk/the-skies-the-limit-for-emblem-inspired-school-of-air-traffic-control-award/ School of Air Traffic Control Memorial Award | Hand Sculpted Award | EFX air traffic controlmemorial awardschoolhandsculpted https://hs.pendleton.k12.or.us/kyle-burnside-memorial-award-and-scholarship/ Kyle Burnside Memorial Award and Scholarship - Pendleton High School memorial awardkyleburnsidescholarshippendleton https://az-directory.com/listings13357009/honoring-flick-family-memorial-award-for-fire-service-excellence Honoring Flick Family Memorial Award for Fire Service Excellence memorial awardfire serviceflickfamilyexcellence https://swe.org/magazine/chipp-swenson-23/ Rodney D. Chipp Memorial Award - Society of Women Engineers For launching outstanding initiatives to retain, promote, and recognize women engineers at Intel; and for remarkable diligence in ensuring the success of the memorial awardrodneychippsocietywomen https://www.surveymonkey.com/r/WRVYNGV 2026 Paul Goodman Memorial Award Nominations Survey Take this survey powered by surveymonkey.com. Create your own surveys for free. paul goodmanmemorial awardnominationssurvey https://cmhlp.org/keshav-desiraju-memorial-award-2023/ Keshav Desiraju Memorial Award 2023 | CMHLP May 16, 2025 - Discover the 2023 Keshav Desiraju Memorial Award winners, honoring excellence in mental health public service, announced on May 11 in a virtual ceremony. memorial awardkeshavcmhlp https://digitalscholarship.tsu.edu/mla_satm_85/905/ "Recommendation, Historical Preservation/Memorial Award" by The Mickey Leland Papers & Collection... historical preservationmemorial awardthe mickeyrecommendation https://cppsocal.org/john-hootman-memorial-award-2021/hootman-2/ John Hootman Memorial Award 2021 - CPP SoCal John Hootman Memorial Award 2021 memorial awardjohncppsocal https://jmc.msu.edu/alumni-giving/giving/klinger Lily Klinger Memorial Award | James Madison College | Michigan State University Learn about the Lily Klinger Memorial Fund at James Madison College, supporting student scholarships for study abroad and field experience opportunities. memorial awardjames madisonmichigan statelilyklinger https://blog.learnlets.com/2017/07/jay-cross-memorial-award-2017-marcia-conner/ Jay Cross Memorial Award 2017: Marcia Conner - Learnlets Oct 16, 2017 - The Jay Cross Memorial Award is presented to a leader in the social and personal learning space. This year's winner is Marcia Conner. memorial awardjaycrossmarciaconner https://mbhockeyhalloffame.ca/ed-sweeney-memorial-award-recipient-geoff-kirbyson/ ED SWEENEY MEMORIAL AWARD RECIPIENT - GEOFF KIRBYSON | Manitoba Hockey Hall of Fame memorial award https://www.bunteng.com/david-tam-memorial-award-2025/ David Tam Memorial Award 2025 - Bunt & Associates: Transportation Planners & Engineers memorial awarddavidtambuntassociates https://blog.robotmak3rs.com/2009/01/james-jessiman-memorial-award-for-2008.html James Jessiman Memorial Award for 2008 awarded to Philippe (Philo) Hurbain The SteerCo is pleased to announce that the James Jessiman Memorial Award (JJMA) for 2008 will be awarded to Philippe (Philo) Hurbain. As a ... james jessiman memorialaward https://ncfs-assn.byu.edu/conference-2/naomi-schor-memorial-award/ Naomi Schor Memorial Award - Nineteenth-Century French Studies AssociationNineteenth-Century French... Aug 27, 2025 - The Naomi Schor Memorial award is given to the best essay by a graduate student giving a presentation at the annual Nineteenth-Century French Studies... memorial awardnineteenth centuryfrench studiesnaomi https://artlyst.com/anne-harild-for-alexandra-reinhardt-memorial-award-residency-at-the-bluecoat-liverpool-2015/ Anne Harild For Alexandra Reinhardt Memorial Award - Artlyst May 8, 2026 - Discover how Anne Harild will contribute her creativity to the Alexandra Reinhardt Memorial Award at Bluecoat in Liverpool. memorial awardannealexandra https://www.scca.com/pages/david-morrell-memorial-award David Morrell Memorial Award - Sports Car Club of America 65,000+ door-to-door, cone clipping and dirt-throwing individuals make us the largest amateur motorsports club in the United States. david morrellmemorial awardsports carclubamerica https://brandonu.academicworks.ca/opportunities/4337 Ananda Balu Memorial Award in Music - Brandon University memorial awardin musicanandabalubrandon https://www.fastweb.com/college-scholarships/scholarships/169736-robert-costa-vasquez-memorial-award Robert Costa Vasquez Memorial Award | Fastweb The Robert Costa Vasquez Memorial Award is open to landscape architecture students at California Polytechnic State University, San Luis Obispo. You must have a... robert costamemorial awardvasquezfastweb https://digestivecancers.eu/campaigning-and-education/wolfram-nolte-memorial-award/ Wolfram Nolte Memorial Award - Digestive Cancers Europe memorial awardwolframnoltedigestivecancers https://chbe.illinois.edu/news/stories/kenis-receives-carl-wagner-memorial-award Kenis receives Carl Wagner Memorial Award | Chemical & Biomolecular Engineering | Illinois Kenis receives Carl Wagner Memorial Award memorial awardreceivescarlwagnerchemical https://www.canberra.edu.au/about-uc/media/newsroom/2020/november/inaugural-john-anstey-memorial-award-presented-at-uc Inaugural John Anstey Memorial Award presented at UC - University of Canberra Advertising graduate Hannah Burton received the award, created to honour the late creative director and University of Canberra lecturer. memorial awarduniversity ofinauguraljohnanstey https://forum.ccgtcc.com/index.php?topic=695.msg1570 2025 Greg Susong Memorial Award VOTING 2025 Greg Susong Memorial Award VOTING memorial awardgregvoting https://www.mediterraneaonline.eu/2025/04/01/marion-brunet-vince-astrid-lindgren-memorial-award-2025/ Marion Brunet vince Astrid Lindgren Memorial Award 2025 - Mediterranea Online Apr 1, 2025 - Scopri Mediterranea Online - La Rivista di Cultura Mediterranea marion brunetastrid lindgrenmemorial awardvincemediterranea https://confederationcollege.academicworks.ca/opportunities/1178 Domenic Barbiero Memorial Award - Confederation College Scholarship Opportunities memorial awardcollege scholarshipdomenicbarbieroconfederation https://honorsandawards.iu.edu/awards/teaching/herman-frederic-lieber.html?page=3& Herman Frederic Lieber Memorial Award: Teaching: Awards: University Honors & Awards : Indiana... Indiana University Herman Frederic Lieber Award memorial awardteaching awardsuniversity honorshermanfrederic https://www.fantastic-arts.org/2015/cfp-jamie-bishop-memorial-award/ CfP: Jamie Bishop Memorial Award | International Association for the Fantastic in the Arts memorial awardinternational association https://njacts.rbhs.rutgers.edu/event/the-daniel-gorenstein-memorial-award-and-lecture/ The Daniel Gorenstein Memorial Award and Lecture - New Jersey Alliance for Clinical and... The Daniel Gorenstein Memorial Award and Lecture via Zoom Dr. Mark Gregory Robson Board of Governors Distinguished Service Professor School of Environmental... the danielmemorial award https://pure.unisabana.edu.co/es/prizes/ruth-greene-memorial-award-2/ Ruth Greene Memorial Award - Universidad de La Sabana memorial awardde laruthgreeneuniversidad https://medicine.utah.edu/pathology/microbiology-immunology/prahl-award James W. Prahl Memorial Award | Pathology | University of Utah Health university of utahmemorial awardjamespathologyhealth https://researchprofiles.canberra.edu.au/en/prizes/monash-university-jeff-northfield-memorial-award-for-excellence-i/ Monash University Jeff Northfield Memorial Award for Excellence in Teacher Research - University of... award for excellencemonash university https://nait.academicworks.ca/opportunities/9733 Alberta Sustainable Resource Development - Michael Berry Memorial Award - NAIT Scholarship... sustainable resourcemichael berrymemorial awardalbertadevelopment https://www.petersons.com/scholarship/jonathan-ormson-memorial-award-in-science-and-technology-111_313530.aspx Jonathan Ormson Memorial Award in Science and Technology - Apply for Scholarships Jonathan Ormson Memorial Award in Science and Technology by Athabasca University science and technologymemorial awardapply forjonathan https://domaininvesting.com/ica-opens-nominations-for-2024-lonnie-borck-memorial-award/ ICA Opens Nominations for 2024 Lonnie Borck Memorial Award | DomainInvesting.com Oct 11, 2023 - The 2024 Lonnie Borck Memorial Award will be given to an "exceptional contribution to fostering a sense of community within the domain name industry." memorial awardicaopensnominations https://photocontestguru.com/contests/rebecca-vassie-memorial-award-2020/ Rebecca Vassie Memorial Award 2020 - Photo Contest Guru The award was created in memory of Rebecca Vassie, a British photographer and photojournalist who died suddenly, aged 30, while on assignment in Uganda memorial awardphoto contestrebeccaguru https://tmdistrict65.org/pat-panfile-ben-luce-memorial-award/ Pat Panfile-Ben Luce Memorial Award - Toastmasters District 65 May 3, 2026 - The Pat Panfile-Ben Luce Memorial Award is considered by many to be the most prestigious award given to a Toastmaster in District 65. The award is generally... memorial awardpatbenlucetoastmasters https://www.insurancenews.com.au/the-professional/warren-tickle-memorial-award-finalists-named Warren Tickle Memorial Award finalists named - Insurance News - insuranceNEWS.com.au memorial awardinsurance newswarrenticklefinalists https://www.dncr.nc.gov/about/history/nc-literary-and-historical-association/awards/christopher-crittenden-memorial-award Christopher Crittenden Memorial Award | NC DNCR memorial awardchristophercrittendennc https://www.fastweb.com/college-scholarships/scholarships/93818-dr-paul-muncy-memorial-award Dr. Paul Muncy Memorial Award | Fastweb The Dr. Paul Muncy Memorial Award is open to senior pre-medicine majors at Union College, Kentucky. You must have the highest cumulative grade average to... memorial awarddrpaulmuncyfastweb https://stg.collegedata.com/scholarship-finder/216384 Scholarship: Leon Brooks Memorial Award (Private Aid) | CollegeData Learn about Leon Brooks Memorial Award (Private Aid) scholarship. From award amount, qualifications, how to apply and much more. Find similar scholarships to... memorial awardscholarshipleonbrooksprivate https://study.anu.edu.au/scholarships/find-scholarship/littleton-groom-memorial-award Littleton Groom Memorial Award | The Australian National University Littleton Groom Memorial Award, The objective of the Award is to provide support to a law student originating from Queensland.Funding for this Award has been... memorial awardthe australianlittletongroomnational https://www.fantastic-arts.org/2008/jamie-bishop-memorial-award-announcement/ Jamie Bishop Memorial Award Announcement | International Association for the Fantastic in the Arts memorial awardinternational association https://www.canadian-universities.net/Scholarships/B/BCIT-December-6-Memorial-Award-for-Women-in-Engineering.html BCIT December 6 Memorial Award for Women in Engineering - Canadian Scholarships Information about BCIT December 6 Memorial Award for Women in Engineering. You can also locate similiar scholarships, awards, prizes and bursaries in Canada. women in engineeringmemorial awardbcitdecember https://therahnuma.com/33rd-yudhvir-foundation-memorial-award-to-dr-gayatri-palat/ 33rd Yudhvir foundation memorial award to Dr. Gayatri Palat - The Rahnuma Daily Apr 26, 2026 - Hyderabad, April 26 (RAHNUMA): The 33rd Yudhvir Foundation Memorial award is being presented to Dr. Gayatri Palat MD, in recognition of her distinguished... memorial award https://www.unb.ca/academics/calendar/undergraduate/current/awards/search/gail-mackinnon-memorial-award.html MacKinnon, Gail, Memorial Award | UNB memorial awardgailunb https://drexel.edu/westphal/academics/undergraduate/DANC/EllenFormanAward/ Ellen Forman Memorial Award | Dance | Undergraduate | Drexel Westphal memorial awardellendanceundergraduatedrexel https://australasia.setac.org/notice/sharmin-akter-wins-the-2022-peter-teasdale-memorial-award Sharmin Akter wins the 2022 Peter Teasdale Memorial Award | SETAC Australasia Sharmin Akter has won the Peter Teasdale Memorial Award sharmin aktermemorial awardwins https://www.sfadb.com/db/A_Bertram_Chandler_Memorial_Award_1999 sfadb: A. Bertram Chandler Memorial Award 1999 memorial awardbertramchandler https://www.ala.org/core/member-center/committees/hugh-c-atkinson-memorial-award-committee?year=2024 Hugh C. Atkinson Memorial Award Committee | Core Honors the life and accomplishments of Hugh C. Atkinson by soliciting nominations and recognizing the outstanding accomplishments of an academic librarian who... memorial awardhughcatkinson https://rhf.org.lb/en/content/rafik-hariri-un-habitat-memorial-award-ny-september-2012 Rafik Hariri UN-Habitat Memorial Award - NY - September 2012 | Rafic Hariri Foundation un habitatmemorial awardrafik https://bollywoodnewsflash.com/4th-national-yash-chopra-memorial-award-for-shahrukh-khan/ 4th National Yash Chopra Memorial Award for ShahRukh Khan Jul 15, 2017 - The 4th National Yash Chopra Memorial Award for ShahRukh Khan is creating ripples across the entire Bollywood fraternity. yash chopramemorial awardnationalkhan https://lakeheadu.academicworks.ca/opportunities/10647 Charles "Chuck" Smith Memorial Award - Lakehead University chuck smithmemorial awardcharleslakeheaduniversity https://www.ncuf.coop/news/lucy-ito-winner-bio/ Celebrating Lucy Ito: Herb Wegner Memorial Award Winner, 2022 - NCUF memorial awardcelebratinglucyitoherb https://bigfuture.collegeboard.org/scholarships/army-engineer-memorial-award Army Engineer Memorial Award - BigFuture Scholarship Search The Army Engineer Memorial Award provides financial assistance for college to the children of members of the Army Engineer Spouses Club. High school seniors... memorial awardarmyengineerscholarshipsearch https://subservicing.cornerstoneservicing.com/2024/03/14/dana-abernathy-cmb-honored-with-prestigious-herschel-greer-memorial-award/ Dana Abernathy, CMB, Honored With Prestigious Herschel Greer Memorial Award | Subservicing memorial awarddanaabernathycmbhonored https://nctr.ca/education/scholarships/helen-betty-osborne-memorial-award-recipients/ Helen Betty Osborne Memorial Award Recipients - NCTR Mar 21, 2025 - Memorial Award Recipients Thank you to everyone who applied to the Helen Betty Osborne Memorial Fund Award. 2023 Recipients 2022 Recipients 2021 Recipients 176... memorial awardhelenbettyosbornerecipients https://radijojo.org/en/salam-aleikum/973/the-first-radijojo-lamya-toubati-memorial-award-goes-to The first Radijojo 'Lamya Toubati Memorial Award' goes to... - Salam Aleikum | Radijojo ... young reporters from Loudaya, Morocco. the firstmemorial award https://oceantic.org/press-releases/network-founder-receives-john-v-kabler-memorial-award/ Network Founder Receives John V. Kabler Memorial Award - Oceantic Network Oct 17, 2023 - Network Founder and CEO Liz Burdock to be recognized by the Maryland League of Conservation Voters for her longstanding dedication to advancing offshore wind... john vmemorial awardnetworkfounderreceives https://hobeybaker.com/awards/memorial-award/ Memorial Award - hobeybaker.com memorial award https://squash.actmasters.org.au/competitions/keith-jones-memorial-award/keith-jones-memorial-award-eligibility-criteria/ ACT Masters Squash | Keith Jones Memorial Award Eligibility Criteria keith jonesmemorial awardactmasterssquash https://connect.uwinnipeg.ca/oliver-bazylewski-memorial-award-in-kinesiology/ Oliver Bazylewski Memorial Award in Kinesiology | Connect with the University of Winnipeg memorial award https://provost.blog.gustavus.edu/2020/05/02/becky-fremo-2020-swenson-bunn-memorial-award-for-teaching-winner-english-department/ Becky Fremo, 2020 Swenson-Bunn Memorial Award for Teaching Winner - Provost memorial awardfor teachingbeckyfremobunn https://www.pelvicpain.org/about/awards/paul-parry-lecture-award The Paul Perry Memorial Award Lecture - IPPS paul perrymemorial awardlectureipps https://carleton.ca/filmstudies/2025/2025-adrian-sheppard-memorial-award-winner/ 2025 Adrian Sheppard Memorial Award Winner - Film Studies Apr 23, 2025 - Adam Saulis is the winner of the Adrian Sheppard Memorial Award for 2025. The professors unanimously chose Adam for his outstanding contributions to the... memorial awardadriansheppardwinnerfilm https://law-journals-books.vlex.com/vid/2023-arthur-j-dixon-1075139739 2023 Arthur J. Dixon Memorial Award. (COLUMNDIXON AWARD) - vLex United States Expert legal books and journals citations and scholarly analysis of 2023 Arthur J Dixon Memorial Award COLUMNDIXON AWARD (No. 55-1, January 2024) with downl... memorial awardarthurjdixonvlex https://www.torontomu.ca/journalism/awards/joe-schlesinger-memorial-award-in-journalism/ Joe Schlesinger Memorial Award in Journalism - School of Journalism - Toronto Metropolitan... memorial awardjournalism schooljoeschlesingertoronto https://gpnmag.com/news/nominations-open-john-holmes-memorial-award/ Nominations Open for John Holmes Memorial Award - Greenhouse Product News Nominations are now being accepted for the America in Bloom John R. Holmes III Community Champion Award, which recognizes an individual who exemplifies... for johnmemorial awardnominationsopenholmes https://hollandcollege.academicworks.ca/opportunities/7068 Mary O'Donnell Memorial Award - Holland College Awards, Bursaries, and Scholarships memorial awardholland collegemarydonnell https://socialsciences.org.au/grants-awards/the-rechnitz-memorial-award/ The Rechnitz Memorial Award | Academy of the Social Sciences in Australia About Nomination process FAQS About the Award The biennial Rechnitz Award is intended to recognise excellence in research leadership and advancement o ... the rechnitz memorial awardacademy of social sciencesaustralia https://hollandcollege.academicworks.ca/opportunities/6682 Elaine E. Gallinger Memorial Award - Holland College Awards, Bursaries, and Scholarships memorial awardholland collegeelaine https://brandonu.academicworks.ca/opportunities/2907 Elva Spalding Memorial Award - Brandon University memorial awardelvaspaldingbrandonuniversity https://swe.org/magazine/chipp-award-chisholm-22/ Rodney D. Chipp Memorial Award - Society of Women Engineers For consistently demonstrating advocacy for women engineers; for ensuring they are heard and respected; and for actively removing barriers to their advancement. memorial awardrodneychippsocietywomen https://www.workwild.ca/scholarships/calvin-r-bohmer-memorial-award Calvin R. Bohmer Memorial Award | Work Wild Scholarships Calvin R. Bohmer Memorial Award scholarship for Forest Technology students. Award amount: Varies. Learn about eligibility requirements and how to apply. memorial awardcalvinworkwildscholarships https://www.petersons.com/scholarship/bob-borgstede-memorial-award-111_313067.aspx Bob Borgstede Memorial Award - Apply for Scholarships Bob Borgstede Memorial Award by Southwestern Illinois College memorial awardapply forbobscholarships https://network.napco.com/print-and-promo/article/strategic-print-alliance-announces-flesh-memorial-award-recipient/ Strategic Print Alliance Announces Flesh Memorial Award Recipient Jul 30, 2015 - In 2010, Strategic Print Alliance established the Flesh Memorial Award in memory of Mr. Royal (Scud) Flesh. Flesh was a founding member of what is now the... memorial awardstrategicprintallianceannounces https://www.chincoteagueponyassociation.com/blog/congratulations-to-the-2025-robert-washburn-memorial-award-winners Congratulations to the 2025 Robert Washburn Memorial Award Winners! - International Chincoteague... congratulations tomemorial awardrobert https://www.dal.ca/faculty/science/earth-environmental-sciences/about/ees-award-holders/david-barlowe-memorial-award.html David Barlow Memorial Award - Department of Earth and Environmental Sciences - Dalhousie University memorial awarddepartment of https://www.acgih.org/subscriptions/awards/awards/2019-robert-t-hughes-memorial-award/ 2019 Robert T. Hughes Memorial Award - ACGIH memorial awardroberthughes https://afam.la.psu.edu/news/the-yaayaa-maria-hunt-memorial-award/ The Yaayaa-Maria Hunt Memorial Award - African American Studies May 9, 2022 - Support the Department of African American Studies in the College of the Liberal Arts with an award in memory of Yaayaa-Maria Hunt, a 2016 alumna. memorial awardafrican americanmariahuntstudies https://chhattisgarh.akshayapatra.org/awards/akshaya-patra-receives-kalam-memorial-award Akshaya Patra Receives Kalam Memorial Award, 2016 On October 15, 2016, The Akshaya Patra Foundation was awarded with the prestigious Kalam Innovation in Governance Award 2016 (KIGA 2016). memorial awardakshayapatrareceiveskalam https://leapscholar.com/scholarship-finder/systems-design-engineering-memorial-award Systems Design Engineering Memorial Award, Eligibility, Application Process, Selection & Contact... Find out details about Systems Design Engineering Memorial Award for an international student, like amount, eligibility, the application process, important... systems designmemorial awardapplication processengineeringeligibility https://oldscollege.academicworks.ca/opportunities/7425 Continuing Education - Mara Coote Feeman Memorial Award - Olds College of Agriculture & Technology... college of agriculturecontinuing educationmemorial award https://www.fastweb.com/college-scholarships/scholarships/1701-joy-ann-vallosio-memorial-award-nursing-scholarship Joy Ann Vallosio Memorial Award Nursing Scholarship | Fastweb The Joy Ann Vallosio Memorial Award Nursing Scholarship is available to full - time students at Illinois Central College. You must be enrolled in the Associate... memorial awardnursing scholarshipjoyannfastweb https://www.rotarymadrassouth.in/events-1/ramakrishna-raja-memorial-award-ceremony Ramakrishna Raja Memorial Award Ceremony | Rotary Madras South Join us for an evening of celebration and recognition as we honor the achievements of our award recipient for the year 2025. memorial awardramakrishnarajaceremonyrotary https://stpetersboyshs.org/tag/joe-ryan-memorial-award/ Joe Ryan Memorial Award Archives - St. Peter's Boys High School joe ryanmemorial awardst peterarchives https://portal.fis.tum.de/en/prizes/ieee-franklin-v-taylor-memorial-award/ IEEE Franklin V. Taylor Memorial Award - Technical University of Munich memorial awarduniversity ofieeefranklintaylor https://nzroses.org.nz/tag/frank-penn-memorial-award/ Frank Penn Memorial Award Archives - The New Zealand Rose Society memorial awardthe newfrankpennarchives https://news.asu.edu/20201228-mars-scientist-christensen-receive-shoemaker-memorial-award Mars scientist Christensen to receive Shoemaker Memorial Award | ASU News Philip R. Christensen, the principal investigator for numerous instruments of Mars exploration carried on NASA spacecraft, will receive the 2011 Eugene... memorial awardmarsscientistchristensenreceive https://internettimealliance.com/jc-memorial-award/ Jay Cross Memorial Award | Internet Time Alliance memorial awardjaycrossinternettime https://culturebrew.art/BCAC-Barbara-Spohr-Memorial-Award-for-Photography-2026 Barbara Spohr Memorial Award for Photography 2026 | Banff Centre for Arts and Creativity Created by the friends and family of the late artist Barbara Spohr, the Barbara Spohr Memorial Award for Photography encourages the development of Canadian... memorial award https://www.appily.com/scholarships/dennis-w-jahnigen-memorial-award Dennis W. Jahnigen Memorial Award | Appily To qualify for this scholarship, applicant must be an AGS member who has provided leadership in training students in geriatrics, and who has contributed... memorial awarddennisappily https://www.aad.org/member/career/awards/sulzberger-lecture Marion B. Sulzberger, MD, Memorial Award and Lectureship Learn more about the Marion B. Sulzberger, MD, Memorial Award and Lectureship, along with how to apply. The selected lecturer will receive a cash award of... memorial awardmarionbmdlectureship https://www.fastweb.com/college-scholarships/scholarships/19239-francis-marcille-60-memorial-award Francis Marcille '60 Memorial Award | Fastweb The Francis Marcille '60 Memorial Award is available to graduating seniors at Fitchburg State College. You must be majoring in industrial technology with a... memorial awardfrancisfastweb https://uwaterloo.ca/entrepreneurship/profiles/jack-rosen-memorial-award-pitch-competition Jack Rosen Memorial Award Pitch Competition | Entrepreneurship | University of Waterloo Jack Rosen Memorial Award Pitch Competition memorial awardpitch competitionuniversity ofjackrosen https://www.llanishenrugbyclub.co.uk/paul-lane-memorial-award-clubman Llanishen Rugby Club | Paul Lane Memorial Award Clubman Llanishen Rugby Football Club - Paul Lane Memorial Clubman of the Year Honours Board paul lanememorial awardllanishenrugbyclub https://hollandcollege.academicworks.ca/opportunities/6798 Kate Cann Memorial Award - Holland College Awards, Bursaries, and Scholarships memorial awardholland collegekatecannawards https://www.drf.com/news/corey-lanerie-named-winner-george-woolf-memorial-jockey-award Corey Lanerie named winner of George Woolf Memorial Jockey Award Corey Lanerie is the winner of the 2014 George Woolf Memorial Jockey Award. Lanerie, 39, was chosen by a nationwide vote of his riding peers from a group of... coreynamedwinnergeorgewoolf https://alma.se/ Astrid Lindgren Memorial Award Astrid Lindgren Memorial Award (ALMA) är ett internationellt litteraturpris för barn och unga. Med prissumman på fem miljoner kronor är det världens största i... astrid lindgrenmemorialaward https://www.sema.org/news-media/enews/2018/33/2018-sema-memorial-scholarship-and-loan-forgiveness-award-winners 2018 SEMA Memorial Scholarship and Loan Forgiveness Award Winners Announced | Specialty Equipment... Aug 16, 2018 - The SEMA Memorial Scholarship Fund awarded $297,000 to 102 individuals this year, including scholarships for current students and loan-forgiveness awards to... memorial scholarshiploan forgiveness