Robuta

https://www.ebi.ac.uk/chembl/explore/document/CHEMBL3414551 Document: Selective inhibitors of protein methyltransferases. (CHEMBL3414551) - ChEMBL Report card for Document Selective inhibitors of protein methyltransferases. (CHEMBL3414551). J Med Chem, Mounting evidence suggests that protein... documentselectiveinhibitorsproteinmethyltransferases https://www.wikidata.org/wiki/Q24614934 The DNA (cytosine-5) methyltransferases - Wikidata the dnacytosinemethyltransferaseswikidata https://www.ebi.ac.uk/chembl/explore/document/CHEMBL1139857 Document: Target-based approach to inhibitors of histone arginine methyltransferases.... Report card for Document Target-based approach to inhibitors of histone arginine methyltransferases. (CHEMBL1139857). J Med Chem, Lysine and arginine... documenttargetbasedapproachinhibitors https://pmc.ncbi.nlm.nih.gov/articles/PMC152790/ SURVEY AND SUMMARY: A nomenclature for restriction enzymes, DNA methyltransferases, homing... A nomenclature is described for restriction endonucleases, DNA methyltransferases, homing endonucleases and related genes and gene products. It provides... restriction enzymessurveysummarynomenclature https://elifesciences.org/reviewed-preprints/86721v1 Coevolution of the CDCA7-HELLS ICF-related nucleosome remodeling complex and DNA methyltransferases https://pmc.ncbi.nlm.nih.gov/articles/PMC110732/ Examination of the DNA substrate selectivity of DNA cytosine methyltransferases using mass tagging... The biological significance of cytosine methylation is as yet incompletely understood, but substantial and growing evidence strongly suggests that perturbation... of theexaminationdnasubstrate https://www.muni.cz/vyzkum/publikace/1835965 The comprehensive interactomes of human adenosine RNA methyltransferases and demethylases reveal... comprehensivehuman https://www.frontiersin.org/journals/microbiology/articles/10.3389/fmicb.2015.00001/full Frontiers | One Juliet and four Romeos: VeA and its methyltransferases Fungal secondary metabolism has become an important research topic with great biomedical and biotechnological value. In the postgenomic era, understanding th... frontiersonejulietfourromeos https://www.frontiersin.org/journals/cell-and-developmental-biology/articles/10.3389/fcell.2022.1007120/full Frontiers | Emerin interacts with histone methyltransferases to regulate repressive chromatin at... X-Linked Emery-Dreifuss muscular dystrophy is caused by mutations in the gene encoding emerin. Emerin is an inner nuclear membrane protein important for repr... histone methyltransferasesfrontiers https://pmc.ncbi.nlm.nih.gov/articles/PMC4422219/ Dysregulated transcriptional and post-translational control of DNA methyltransferases in cancer -... Cancer is a leading cause of death worldwide. Aberrant promoter hypermethylation of CpG islands associated with tumor suppressor genes can lead to... transcriptionalposttranslational https://www.frontiersin.org/journals/physiology/articles/10.3389/fphys.2017.00870/full Frontiers | Regulation of Skeletal Muscle Plasticity by Protein Arginine Methyltransferases and... Protein arginine methyltransferases (PRMTs) are a family of enzymes that catalyze the methylation of arginine residues on target proteins, thereby mediating ... skeletal muscleby proteinfrontiersregulation