Robuta

https://www.mdpi.com/1422-0067/23/5/2407 The Dynamic Regulation of G-Quadruplex DNA Structures by Cytosine Methylation It is well known that certain non B-DNA structures, including G-quadruplexes, are key elements that can regulate gene expression. Here, we explore the theory... dna structuresdynamicregulation https://www.wikidata.org/wiki/Q24614934 The DNA (cytosine-5) methyltransferases - Wikidata the dnacytosinemethyltransferaseswikidata https://pmc.ncbi.nlm.nih.gov/articles/PMC39484/ Increased cytosine DNA-methyltransferase activity is target-cell-specific and an early event in... The association between increased DNA-methyltransferase (DNA-MTase) activity and tumor development suggest a fundamental role for this enzyme in the initiation... https://www.wikidata.org/wiki/Q35686473 Chemical modification of cytosine residues of U6snRNA with hydrogen sulfide (Nudeoddes and... scientific article published on September 10, 1983 hydrogen sulfidechemicalmodificationcytosine https://www.ncbi.nlm.nih.gov/protein/WP_001296139.1 MULTISPECIES: 16S rRNA (cytosine(1407)-C(5))-methyltransferase RsmF [E - Protein - NCBI https://www.semanticscholar.org/topic/Adenosine-to-Cytosine-Transversion-Abnormality/10862374 Adenosine to Cytosine Transversion Abnormality | Semantic Scholar A point mutation involving the substitution of Cytosine (a pyrimidine base) for Adenosine (a purine base) in a DNA sequence from eukaryotic or prokaryotic... adenosinecytosineabnormalitysemanticscholar https://www.ebi.ac.uk/chebi/CHEBI:43597 1-(2-deoxy-beta-L-ribofuranosyl)cytosine (CHEBI:43597) deoxybetalcytosinechebi https://www.semanticscholar.org/topic/Site-Specific-DNA-Methyltransferase/10864039 Site-Specific DNA Methyltransferase (Cytosine-Specific) | Semantic Scholar Enzymes responsible for producing a species-specific methylation pattern on cytosine residues. site specificdna methyltransferasecytosinesemanticscholar https://www.ncbi.nlm.nih.gov/Structure/pdb/3OVA 3OVA: How the CCA-adding Enzyme Selects Adenine over Cytosine in Position 76 of tRNA CCA-adding enzymeRNA (34-MER)1,2-ETHANEDIOLDIPHOSPHOMETHYLPHOSPHONIC ACID ADENOSYL ESTERMAGNESIUM IONSULFATE ION https://everything2.com/title/cytosine cytosine structural formula of cytosine: H / H -- N H \ / C -- C // \\ N C -- H \ / C -- N // O See also: adenine, thymine, guanine, and uracil. cytosine https://www.muni.cz/vyzkum/publikace/983980 ELECTROCHEMICAL STUDY OF SHORT CYTOSINE OLIGONUCLEOTIDES | Masarykova univerzita | MUNI masarykova univerzitaelectrochemicalstudyshortcytosine https://www.thermofisher.com/antibody/primary/panther/tRNA%20(cytosine-2'-O-)-methyltransferase%20activity tRNA (cytosine-2'-O-)-methyltransferase activity Antibodies | Invitrogen Antibodies for proteins involved in tRNA (cytosine-2'-O-)-methyltransferase activity pathways, according to their Panther/Gene Ontology Classification trnacytosineactivityantibodiesinvitrogen https://www.ncbi.nlm.nih.gov/protein/6X9J_A Chain A, DNA (cytosine-5)-methyltransferase 1 - Protein - NCBI chaindnacytosineproteinncbi https://www.wolframalpha.com/input?i=cytosine cytosine - Wolfram|Alpha cytosinewolframalpha https://www.rcsb.org/structure/1NKE RCSB PDB - 1NKE: A BACILLUS DNA POLYMERASE I PRODUCT COMPLEX BOUND TO A CYTOSINE-THYMINE MISMATCH... A BACILLUS DNA POLYMERASE I PRODUCT COMPLEX BOUND TO A CYTOSINE-THYMINE MISMATCH AFTER A SINGLE ROUND OF PRIMER EXTENSION, FOLLOWING INCORPORATION OF DCTP. https://elifesciences.org/reviewed-preprints/103432v1 Introduction of cytosine-5 DNA methylation sensitizes cells to oxidative damage dna methylationintroductioncytosine https://www.ebi.ac.uk/chebi/CHEBI:16040 cytosine (CHEBI:16040) An aminopyrimidine that is pyrimidin-2-one having the amino group located at position 4. cytosinechebi https://elifesciences.org/articles/70021 A genome-phenome association study in native microbiomes identifies a mechanism for cytosine... A novel DNA/RNA modifying enzyme catalyzing a previously unknown 5-carbamoyloxymethylcytosine modification has been discovered using a novel framework called... study in https://www.wikidata.org/wiki/Q77406653 An inverted repeat triggers cytosine methylation of identical sequences in Arabidopsis - Wikidata scientific article published on 01 April 1999 https://www.rcsb.org/structure/2YJY RCSB PDB - 2YJY: A specific and modular binding code for cytosine recognition in PUF domains A specific and modular binding code for cytosine recognition in PUF domains https://www.ncbi.nlm.nih.gov/protein/6W8D_B Chain B, DNA (cytosine-5)-methyltransferase 3-like - Protein - NCBI chainbdnacytosinelike https://pmc.ncbi.nlm.nih.gov/articles/PMC110732/ Examination of the DNA substrate selectivity of DNA cytosine methyltransferases using mass tagging... The biological significance of cytosine methylation is as yet incompletely understood, but substantial and growing evidence strongly suggests that perturbation... of theexaminationdnasubstrate https://www.spandidos-publications.com/10.3892/or.2013.2584 Adenosine potentiates the therapeutic effects of neural stem cells expressing cytosine deaminase... Oncology Reports is an international journal devoted to fundamental and applied research in Oncology. neural stem cells https://alchetron.com/Cytosine Cytosine - Alchetron, The Free Social Encyclopedia Jan 24, 2026 - Cytosine (satsin, zin, sn C) is one of the four main bases found in DNA and RNA, along with adenine, guanine, and thymine (uracil in RNA). It is a pyrimidine... the freecytosinesocialencyclopedia https://www.ebi.ac.uk/chebi/CHEBI:43955 molybdopterin cytosine dinucleotide (CHEBI:43955) cytosinechebi https://www.ncbi.nlm.nih.gov/protein/1R9Z_A Chain A, Cytosine deaminase - Protein - NCBI chaincytosineproteinncbi https://www.semanticscholar.org/topic/Cytosine-Thymine-Dimers/8908662 Cytosine-Thymine Dimers | Semantic Scholar cytosinethyminedimerssemanticscholar https://www.genome.gov/genetics-glossary/Cytosine Cytosine Cytosine (C) is one of four chemical bases in DNA, the other three being adenine (A), guanine (G), and thymine (T). cytosine https://www.muni.cz/en/research/publications/1536658 Genome sizes and genomic guanine+cytosine (GC) contents of the Czech vascular flora with new... https://www.frontiersin.org/journals/genetics/articles/10.3389/fgene.2023.1231415/full Frontiers | DNA cytosine deamination is associated with recurrent Somatic Copy Number Alterations... Stomach Adenocarcinoma (STAD) is a leading cause of death worldwide. Somatic Copy-Number Alterations (SCNAs), which result in Homologous recombination (HR) d... is associated with https://www.semanticscholar.org/topic/copper-incorporation-via-L-cysteinyl-copper-sulfido/5534052 copper incorporation via L-cysteinyl copper sulfido molybdopterin cytosine dinucleotide | Semantic... The incorporation of copper into a protein by L-cysteinyl copper sulfido molybdopterin cytosine dinucleotide. [RESID:AA0355] copperincorporationvialcytosine https://www.ebi.ac.uk/chembl/explore/compound/CHEMBL15913 Compound: CYTOSINE (CHEMBL15913) - ChEMBL Report card for Compound CYTOSINE (CHEMBL15913). C4H5N3O, Small molecule, CYTOSINE, LAMIVUDINE IMPURITY C, LAMIVUDINE IMPURITY C RS, NSC-27787. compoundcytosinechembl https://www.semanticscholar.org/topic/cytosine-thymine-mispair-binding/8764617 cytosine/thymine mispair binding | Semantic Scholar Interacting selectively and non-covalently with double-stranded DNA containing a C/T mispair. [GOC:bf, GOC:jh] cytosinethyminebindingsemanticscholar https://www.cancerresearchuk.org/about-cancer/treatment/drugs/cytarabine Cytarabine (Ara C, cytosine arabinoside) | Cancer information | Cancer Research UK Cytarabine is a type of chemotherapy. It is a treatment for a number of different cancer types. Find out about how you have it, possible side effects and other... cancer informationcytarabinecytosineresearchuk https://www.ebi.ac.uk/chebi/CHEBI:181445 Cytosine arabinoside monophosphate (CHEBI:181445) cytosinechebi https://www.rcsb.org/structure/1DCT RCSB PDB - 1DCT: DNA (CYTOSINE-5) METHYLASE FROM HAEIII COVALENTLY BOUND TO DNA DNA (CYTOSINE-5) METHYLASE FROM HAEIII COVALENTLY BOUND TO DNA rcsb pdb https://www.semanticscholar.org/topic/DNA-methylation-on-cytosine-within-a-CNG-sequence/10851121 DNA methylation on cytosine within a CNG sequence | Semantic Scholar The covalent transfer of a methyl group, to C-5 or N-4, of a cytosine located within a CNG sequence in a DNA molecule. N stands for any nucleotide. [GOC:dph,... dna methylationcytosinewithincngsequence