Robuta

https://covidment.is/ Mental Morbidity trajectories in COVID-19 - COVIDMENT Nov 6, 2024 - The COVIDMENT project was designed to significantly advance current knowledge of mental morbidity trajectories in the COVID-19 pandemic mentalmorbiditytrajectoriescovid https://digitalcommons.unl.edu/sociologyfacpub/615/ "Erratum: A Comprehensive Analysis of Morbidity Life Expectancies Among" by Marc A. Garcia,... By Marc A. Garcia, Catherine Garcia, Chi-Tsun Chiu, et al., Published on 01/01/18 comprehensive analysis https://stacks.cdc.gov/view/cdc/7285 Morbidity and Mortality Weekly Report: Recommendations and Reports, May 17, 2002 / Vol. 51 / No.... CDC recommends that all states and territories conduct case surveillance for human immunodeficiency virus (HIV) infection as an extension of CURRENT acquired... morbidity and mortality https://www.ndph.ox.ac.uk/study-with-us/dphil-population-health/dphil-research-projects/2021-dphil-projects/understanding-the-role-of-genetic-drift-selection-and-consanguinity-in-morbidity-and-mortality-in-the-china-kadoorie-biobank?071038ce-5017-11f1-bd2c-4b873b439f5b Understanding the role of genetic drift, selection, and consanguinity in morbidity and mortality in... the rolegenetic drift https://icap.columbia.edu/tools_resources/morbidity-and-mortality-from-covid-19-post-vaccination-breakthrough-infections-in-association-with-vaccines-and-the-emergence-of-variants-in-bahrain-2/ Morbidity and Mortality from COVID-19 Post-Vaccination Breakthrough Infections in Association with... morbidity and mortality https://stacks.cdc.gov/view/cdc/922 Morbidity and Mortality Weekly Report, Vol. 19, No. 37, week ending September 19, 1970 Epidemiological notes on specified notifiable diseases in the United States. This issue includes discussions of poliomyelitis, plague, malaria, enterovirus... morbidity and mortality https://econpapers.repec.org/article/binbpeajo/v_3a48_3ay_3a2017_3ai_3a2017-01_3ap_3a397-476.htm EconPapers: Mortality and Morbidity in the 21st Century By Anne Case and Angus Deaton; Mortality and Morbidity in the 21st Century in theeconpapersmortalitymorbiditycentury https://researchportalplus.anu.edu.au/en/publications/measures-of-self-reported-morbidity-according-to-age-gender-and-g/ Measures of self-reported morbidity according to age, gender and general medical services... https://researchconnect.buffalo.edu/en/publications/link-between-nocturnal-hypoventilation-and-hypoxia-on-arrhythmias/ Link between nocturnal hypoventilation and hypoxia on arrhythmias/CV morbidity in neuromuscular... https://stacks.cdc.gov/view/cdc/26764 Morbidity and Mortality Weekly Report (MMWR): Surveillance Summaries, April 2011 / Vol. 60 / No.... Problem/Condition: Estimated trends in county-level vaccination coverage compared with national health objectives and associated with other variables (e.g.,... morbidity and mortality https://www.cordis.europa.eu/project/id/666676/reporting/fr Moving to Efficient Diabetes care: Multimode Integrated CO-morbidity diagnostics platform | H2020 |... Latest report summary moving todiabetes care https://stacks.cdc.gov/view/cdc/27197 MMWR. Morbidity and Mortality Weekly Report, Vol. 48, No. 41, October 22, 1999 Epidemiological notes on specified notifiable diseases in the United States. This issue includes Public Health Surveillance, Cost-Benefit Analysis, Dental... morbidity and mortality https://saramarkowitz.netlify.app/publication/2023-07-01_aca_medicaid_expansion/ Affordable Care Act Medicaid Expansions and Maternal Morbidity | Sara Markowitz Jul 17, 2023 - In this paper, we test whether the Affordable Care Act Medicaid expansions are associated with in-hospital maternal morbidity. The ACA expansions may have... affordable care actmedicaidexpansionsmaternalmorbidity https://pmc.ncbi.nlm.nih.gov/articles/PMC4205264/ Impact of weight cycling on risk of morbidity and mortality - PMC Unintentional weight gain is commonly observed in adult humans, often provoking intentional weight loss attempts followed by unintentional weight regain. This... morbidity and mortalityimpactweightcyclingrisk https://stacks.cdc.gov/view/cdc/114185 Morbidity and Mortality Weekly Report: Supplement, January 14, 2022 / Vol. 71 / No.1 CDC is the nation's premier health promotion, Prevention, and preparedness agency. As such, CDC is an important source of public health and clinical... morbidity and mortality https://stacks.cdc.gov/view/cdc/26842 Morbidity and Mortality Weekly Report (MMWR), October 15, 1993 / Vol. 42 / No. 40 Epidemiological notes on specified notifiable diseases in the United States. This issue includes Public Health Surveillance, Adolescent, Adolescent Behavior... morbidity and mortality https://www.scirp.org/journal/PaperInformation?PaperID=77114& A Chronic Post-Surgical Infectious Lumbar Fistula Providing Protection against Imminent Morbidity:... Rare case of chronic lumbar post-surgical infection requiring surgical intervention. Learn about the importance of prompt evaluation and treatment for VOM and... post surgical https://research.monash.edu/en/publications/neonatal-morbidity-after-induction-vs-expectant-monitoring-in-int-2/ Neonatal morbidity after induction vs expectant monitoring in intrauterine growth restriction at... https://ideas.repec.org/a/eee/jeeman/v119y2023ics0095069623000335.html The effects of contemporaneous air pollution on COVID-19 morbidity and mortality Downloadable (with restrictions)! We examine the relationship between contemporaneous fine particulate matter exposure and COVID-19 morbidity and mortality... air pollution https://doh.wa.gov/uk/node/5361 Sexually Transmitted Infections Morbidity Reports | Washington State Department of Health The reports below are Washington State's annual reports for sexually transmitted infections. They include morbidity data, incidence rates by county, and the... sexually transmittedwashington statedepartment ofinfectionsmorbidity https://scholarworks.gsu.edu/items/e81cac4f-8e76-4ed1-a819-0852426bc262 Substantial morbidity and mortality associated with pandemic A/H1N1 influenza in Mexico, winter... morbidity and mortality https://journals.plos.org/plosmedicine/article?id=10.1371/journal.pmed.1002718 A new aging measure captures morbidity and mortality risk across diverse subpopulations from NHANES... Morgan Levine and colleagues describe a phenotypic aging model which can predict health outcomes in individuals from different populations taking into account... https://pubmed.ncbi.nlm.nih.gov/38777357/ Epidural analgesia during labour and severe maternal morbidity: population based study Epidural analgesia during labour was associated with a 35% reduction in SMM, and showed a more pronounced effect in women with medical indications for epidural... epidural analgesialabour https://experts.mcmaster.ca/scholarly-works/210877 Follow-up of Psychiatric and Educational Morbidity... Learn about the scholarly work entitled Follow-up of Psychiatric and Educational Morbidity... follow uppsychiatriceducationalmorbidity https://pubmed.ncbi.nlm.nih.gov/16300480/ Telomere length in white blood cells is not associated with morbidity or mortality in the oldest... Cross-sectional studies have repeatedly suggested peripheral blood monocyte telomere length as a biomarker of aging. To test this suggestion in a large... https://www.scirp.org/journal/paperinformation?paperid=55761 Can Bladder Irrigation Reduce the Morbidity of Bladder Stone in Patients with Spinal Cord Injury? Objective: To assess the safety and efficacy of bladder irrigation for reducing the morbidity of bladder stones in patients with neurological lower urinary... https://pubmed.ncbi.nlm.nih.gov/34972599/ Ways Forward in Preventing Severe Maternal Morbidity and Maternal Health Inequities: Conceptual... Ways Forward in Preventing Severe Maternal Morbidity and Maternal Health Inequities: Conceptual Frameworks, Definitions, and Data, from a Population Health... health inequitieswaysforwardpreventingsevere https://www.mdpi.com/2072-6694/13/9/2056 Fibrin Sealants and Axillary Lymphatic Morbidity: A Systematic Review and Meta-Analysis of 23... Background: use of fibrin sealants following pelvic, paraaortic, and inguinal lymphadenectomy may reduce lymphatic morbidity. The aim of this meta-analysis is... https://pubmed.ncbi.nlm.nih.gov/20683553/ Self-reported morbidity and its conditionings in children 5 to 9 years old in Sobral, CE, Brazil A high prevalence of DRS was observed in children in the main urban center. DRS prevalence was about twice higher than that observed in other studies with... https://www.demogr.mpg.de/en/research_6120/independent_research_groups_11668/kinship_inequalities_10703/morbidity_multimorbidity_and_their_socioeconomic_and_sociodemographic_determinants_among_immigrants_and_natives_in_norway_14161 MPIDR - Morbidity, Multimorbidity, and Their Socioeconomic and Sociodemographic Determinants Among... The Max Planck Institute for Demographic Research (MPIDR) in Rostock is one of the leading demographic research centers in the world. It's part of the Max... morbiditysocioeconomicdeterminantsamong https://pmc.ncbi.nlm.nih.gov/articles/PMC7983846/ Matters of the heart: Grief, morbidity, and mortality - PMC Spousal bereavement is associated with an elevated risk of morbidity and mortality. Several well-regarded multidisciplinary research teams have sought to... matters of the heartmorbidity and mortalitygriefpmc https://about.ebsco.com/clinical-decisions/dynamed-solutions/about/ebm-focus/hard-statistics-suggest-hard-reality Hard statistics suggest a hard reality for racial/ethnic disparities and maternal morbidity | EBM... https://www.cochrane.org/zh-hans/evidence/CD004697_prophylactic-antibiotics-reduce-morbidity-and-mortality-neonates-umbilical-artery-catheters Prophylactic antibiotics to reduce morbidity and mortality in neonates with umbilical artery... morbidity and mortality https://pubmed.ncbi.nlm.nih.gov/27992624/ Association of Perioperative Statin Use With Mortality and Morbidity After Major Noncardiac Surgery Early perioperative exposure to a statin was associated with a significant reduction in all-cause perioperative mortality and several cardiovascular and... https://www.cochrane.org/zh-hans/evidence/CD001457_glutamine-supplementation-prevent-morbidity-and-mortality-preterm-infants Glutamine supplementation to prevent morbidity and mortality in preterm infants | Cochrane morbidity and mortalityglutaminesupplementationprevent https://biblio.ugent.be/publication/132348 Early predictors of mortality and morbidity after severe closed head injury. earlypredictorsmortality https://www.frontiersin.org/journals/aging-neuroscience/articles/10.3389/fnagi.2013.00056/full Frontiers | Co-morbidity of depression and anxiety in common age-related eye diseases: a... This study examined the prevalence of co-morbid age-related eye disease and symptoms of depression and anxiety in late life, and the relative roles of visual... https://stacks.cdc.gov/view/cdc/5854 Morbidity and Mortality Weekly Report (MMWR): Surveillance Summaries, February 2011 / Vol. 60 / No.... "Problem/Condition: Since 1969, CDC has conducted abortion surveillance to document the number and characteristics of women obtaining legal induced abortions... morbidity and mortality https://questioning-answers.blogspot.com/2019/05/childhood-neuropsychiatric-morbidity-prenatal-exposure-preeclampsia-not-autism.html Questioning Answers: Childhood "neuropsychiatric morbidity" and prenatal exposure to pre-eclampsia... Childhood "neuropsychiatric morbidity" and prenatal exposure to pre-eclampsia (but not autism) questioninganswerschildhoodneuropsychiatricmorbidity https://mbouffant.blogspot.com/2022/05/monday-lake-mead-morbidity-report.html WEB OF EVIL (& ENNUI): Monday Lake Mead Morbidity Report The future's uncertain, the end is always near ... web of evillake meadennuimondaymorbidity https://scholars.duke.edu/publication/1602063 Scholars@Duke publication: Fatigue, pain interference, and psychiatric morbidity in multiple... scholarsdukepublicationfatiguepain https://pubmed.ncbi.nlm.nih.gov/21855965/ Prediction of morbidity and mortality after percutaneous nephrolithotomy by using the Charlson... CCI is a quick, simple, and reproducible scoring system that accurately predicts the morbidity and mortality of PCNL. morbidity and mortality https://portal.fis.tum.de/en/publications/the-role-of-co-morbidity-in-the-selection-of-antidiabetic-pharmac/ The role of co-morbidity in the selection of antidiabetic pharmacotherapy in type-2 diabetes -... the role https://ibis.utah.gov/ibisph-view/indicator/related/RiskFactors/MatMorb.html IBIS-PH - Related Health Indicator Reports - Severe maternal morbidity among hospital deliveries https://cordis.europa.eu/project/id/101032087 ATTributing heAt-related excess mortality and morbidity to Climate cHange | ATTACH | Project | Fact... Climate change is known to affect deaths and hospitalizations associated with heat exposure in Europe. Yet, despite a broad epidemiological knowledge base on... https://cme.uchicago.edu/cme-morning-lecture-series---rss-nseped01-17-18/content/tba-51 Morbidity and Mortality | Center for Continuing Medical Education Objectives:Review of cases requiring transer - what systems should we have in place to improve patient safetyDisease pathophysiologyDisease complications... morbidity and mortalitycenter forcontinuingmedicaleducation https://soc.washington.edu/fields/morbiditymortality Morbidity/Mortality | Department of Sociology | University of Washington department of sociologymorbiditymortalityuniversitywashington https://www.cdc.gov/mmwr/author_guide.html Morbidity and Mortality Weekly Report (MMWR) Weekly | MMWR The Morbidity and Mortality Weekly Report (MMWR) Series is prepared by the Centers for Disease Control and Prevention (CDC). morbidity and mortalityweekly reportmmwr https://researchportalplus.anu.edu.au/en/publications/laryngeal-mask-airway-surfactant-administration-for-prevention-of-3/ Laryngeal mask airway surfactant administration for prevention of morbidity and mortality in... laryngeal mask airwaymorbidity and mortality https://odphp.health.gov/healthypeople/tools-action/browse-evidence-based-resources/aspirin-use-prevent-preeclampsia-and-related-morbidity-and-mortality-preventive-medication Aspirin Use to Prevent Preeclampsia and Related Morbidity and Mortality: Preventive Medication -... The U.S. Preventive Services Task Force recommends the use of low-dose aspirin to prevent preeclampsia in people who are more than 12 weeks pregnant and are at... aspirinusepreventpreeclampsia https://experts.arizona.edu/en/publications/long-term-effect-of-endothelin-receptor-antagonism-with-bosentan-/ Long-Term Effect of Endothelin Receptor Antagonism With Bosentan on the Morbidity and Mortality of... https://umu.diva-portal.org/smash/record.jsf?pid=diva2:1817149 Morbidity among working class men and women in early twentieth century Sweden men and womenearly twentieth centuryworking class https://eprints.ncl.ac.uk/5580 Maternal morbidity: vesico-vaginal fistulas in developing countries - ePrints - Newcastle University developing countriesmaternalmorbidityvaginalfistulas https://pubmed.ncbi.nlm.nih.gov/21194742/ Parental psychosocial stress and asthma morbidity in Puerto Rican twins Both paternal and maternal psychosocial factors can influence asthma morbidity in young Puerto Rican children. puerto ricanparentalpsychosocialstressasthma https://pubmed.ncbi.nlm.nih.gov/16360210/ Microbial keratitis predisposing factors and morbidity Ocular trauma and CL wear are the major predisposing factors for microbial keratitis in this age range. These cases require significant hospital resources... microbialkeratitisfactorsmorbidity https://stacks.cdc.gov/view/cdc/592 Morbidity and Mortality Weekly Report, Vol. 13, No. 43, for Release October 30, 1964 Provides provisional information on selected notifiable diseases in the United States and on deaths in selected cities for the week ended October 24, 1964. morbidity and mortality https://stacks.cdc.gov/view/cdc/1011 Morbidity and Mortality Weekly Report, For release November 1, 1957, Vol. 6, No. 43 Provisional Information on Selected Notifiable Diseases in the United States and on Deaths in Selected Cities for Week Ended October 26, 1957 morbidity and mortality https://pure.psu.edu/en/publications/the-association-of-nicu-capacity-strain-with-neonatal-mortality-a/ The association of NICU capacity strain with neonatal mortality and morbidity - Penn State https://pubmed.ncbi.nlm.nih.gov/40633928/ Perinatal Substance Use and Factors Associated With Maternal and Neonatal Morbidity and Mortality People with PSUD had 2 times higher rates of maternal and neonatal morbidity and mortality than provincial rates. Odds of maternal mortality increased 11%... perinatal substance useassociated withfactors https://alert.ki.se/ Homepage - ALERT - Action Leveraging Evidence to reduce perinatal Mortality and morbidity in... Apr 9, 2024 - Intervention - Research project - Meeting - Europe - Africa - Sub-saharan - Maternity - Newborn - Public health - Benin - Malawi - Tanzania - Uganda -... https://pmc.ncbi.nlm.nih.gov/articles/PMC10593119/ Maternal morbidity and mortality among patients with cancer at time of delivery - PMC Individuals with cancer during pregnancy are a medically complex patient population that is anticipated to grow. A better understanding of this population and... morbidity and mortality https://ja.dh.duke.edu/vascular-surgery-multidisciplinary-conference-fy25/content/vascular-surgery-morbidity-and-mortality-conference-0 Vascular Surgery Morbidity and Mortality Conference | DUKEHealth JA morbidity and mortalityvascular surgeryconferenceja https://hspop.uw.edu/publication/population-based-study-of-risk-factors-for-severe-maternal-morbidity/ Population-based study of risk factors for severe maternal morbidity. - Health Systems and... Gray KE, Wallace ER, Nelson KR, Reed SD, Schiff MA. Population-based study of risk factors for severe maternal morbidity. Paediatr Perinat Epidemiol. 2012... https://collections.nlm.nih.gov/catalog/nlm:nlmuid-101584929X74-doc Effects of Treatment on Morbidity in Hypertension: II. Results in Patients with Diastolic Blood... https://pediatrics.ucsf.edu/node/344046 The association of plasma IL-6 with measures of asthma morbidity in a moderate-severe pediatric... https://employercoverage.substack.com/p/a-genetic-treatment-for-hemophilia/comments Comments - A genetic treatment for Hemophilia B, severe maternal morbidity, and engaging diabetics... https://research.wur.nl/en/publications/mapping-geographical-inequalities-in-childhood-diarrhoeal-morbidi/ Mapping geographical inequalities in childhood diarrhoeal morbidity and mortality in low-income and... morbidity and mortalitymappinggeographicalinequalitieschildhood https://asprtracie.hhs.gov/technical-resources/resource/11315/a-framework-for-assessing-mortality-and-morbidity-after-large-scale-disasters A Framework for Assessing Mortality and Morbidity After Large-Scale Disasters | Technical Resources... Search the ASPR TRACIE Resource Library and view tailored Topic Collections comprised of current healthcare system preparedness resources. https://cpo.weill.cornell.edu/publications/double-disparity-low-socioeconomic-status-patients-postoperative-morbidity-following Double disparity for low socioeconomic status patients in postoperative morbidity following total... Aug 1, 2019 - WCM | Center for Perioperative Outcomes | Double disparity for low socioeconomic status patients in postoperative morbidity following total hip arthroplasty | socioeconomic status https://eprints.ncl.ac.uk/99103 Indwelling stents after ureteroscopy - Can cause significant postoperative morbidity and should be... can cause https://njacts.rbhs.rutgers.edu/event/medical-grand-rounds-morbidity-mortality/ Medical Grand Rounds-Morbidity & Mortality - New Jersey Alliance for Clinical and Translational... medical grand roundsnew jersey https://microbirth.teachable.com/courses/gbs/lectures/5453647 15. Key morbidity and mortality statistics from around the world | MIC Evidence-based course for health professionals featuring 5 experts. from around the worldmorbidity and mortalitykey https://www.techtransfer.nih.gov/patent/e-214-2018-0-ep-03 PHENOTYPIC AGE AND DNA METHYLATION BASED BIOMARKERS FOR LIFE EXPECTANCY AND MORBIDITY | Technology... dna methylation https://hsrc.himmelfarb.gwu.edu/gwhpubs/1572/ "Thirty-day morbidity and mortality following revision total shoulder a" by Puneet Gupta, Theodore... Background: Octogenarians are at an increased risk of morbidity and mortality following various surgeries, but this has not yet been well explored in... https://stacks.cdc.gov/view/cdc/32893 MMWR. Morbidity and Mortality Weekly Report. Notifiable Diseases and Mortality Tables, Vol. 63, No.... morbidity and mortalityweekly report https://www.formstack.com/templates/confidential-morbidity-report-form Confidential Morbidity Report Form | Formstack Formstack's Confidential Morbidity Report Form streamlines incident reporting. Capture details on mobile and notify the right team in real time. morbidity reportconfidentialform https://blog.soton.ac.uk/edpsych/2015/12/18/the-co-morbidity-of-autism-spectrum-condition-and-oppositional-defiant-disorder-so-what/ The Co-morbidity of Autism Spectrum Condition and Oppositional Defiant Disorder. So What? |... autism spectrum condition https://about.uq.edu.au/experts/project/31407 Reducing morbidity and mortality in infants and children after cardiopulmonary bypass - a... morbidity and mortalitycardiopulmonary bypassreducing https://pure.psu.edu/en/publications/differences-in-morbidity-and-mortality-with-percutaneous-versus-o/ Differences in morbidity and mortality with percutaneous versus open surgical drainage of... morbidity and mortality https://stacks.cdc.gov/view/cdc/1261 Morbidity and Mortality Weekly Report (MMWR), June 5, 1981 / Vol. 30 / No. 21 Epidemiological notes on specified notifiable diseases in the United States. This issue includes information on Dengue infections, pneumocystis pneumonia,... morbidity and mortality https://pubmed.ncbi.nlm.nih.gov/11082085/ Maternal morbidity and mortality associated with interpregnancy interval: cross sectional study Interpregnancy intervals less than 6 months and longer than 59 months are associated with an increased risk of adverse maternal outcomes. morbidity and mortalityassociated withmaternal https://chibe.upenn.edu/publications/cdc-morbidity-and-mortality-weekly-report/ CDC Morbidity and Mortality Weekly Report - Center for Health Incentives and Behavioral Economics... morbidity and mortalityweekly report https://oie.duke.edu/event/duke-anesthesiology-grand-rounds-anesthesiology-morbidity-mortality-conference-11-05-2025/ Duke Anesthesiology Grand Rounds - "Anesthesiology Morbidity & Mortality Conference" | Office for... grand roundsconference officedukeanesthesiologymorbidity https://journals.plos.org/plosone/article/comments?id=10.1371/journal.pone.0137714 Individual Effect Modifiers of Dust Exposure Effect on Cardiovascular Morbidity | PLOS One Background High concentrations of particulate matter (PM) air pollution have been associated with death and hospital admissions due to cardiovascular... dust exposureindividualeffectmodifiers https://www.ncbi.nlm.nih.gov/books/NBK555593/ The Benefits of Smoking Cessation on Overall Morbidity, Mortality, and Economic Costs - Smoking... Cigarette smoking causes multiple diseases and reduces the general level of health of smokers (U.S. Department of Health and Human Services [USDHHS] 2004,... the benefitssmoking cessation https://repository.tudelft.nl/record/uuid:a18480c2-e8fe-445d-9fbf-4ca7e1183b85 Spatio-temporal evaluation of air quality and its influence on morbidity | TU Delft Repository https://bsnorrell.blogspot.com/2016/11/standing-rock-medics-urge-army-corps-to.html?showComment=1480527220971 CENSORED NEWS: Standing Rock Medics Urge Army Corps to Rescind Eviction Notice to Prevent Morbidity... Censored News is a service to grassroots Indigenous Peoples engaged in resistance and upholding human rights. https://scholars.uky.edu/en/projects/the-kentucky-severe-maternal-morbidity-and-mortality-task-force-s-2/ The Kentucky Severe Maternal Morbidity and Mortality Task Force: State Maternal Health Innovation... morbidity and mortality https://pmc.ncbi.nlm.nih.gov/articles/PMC9914526/?ref=thepersistent.com Listen to the Whispers before They Become Screams: Addressing Black Maternal Morbidity and... Black women in the United States (U.S.) disproportionately experience adverse pregnancy outcomes, including maternal mortality, compared to women of other... https://coeh.ph.ucla.edu/publication/mortality-and-morbidity-during-extreme-heat-events-and-prevalence-of-outdoor-work-an-analysis-of-community-level-data-from-los-angeles-county-california/ Mortality and Morbidity during Extreme Heat Events and Prevalence of Outdoor Work: An Analysis of... https://explorer.cuni.cz/publication/329431 Macitentan and Morbidity and Mortality in Pulmonary Arterial Hypertension | Charles Explorer Macitentan and Morbidity and Mortality in Pulmonary Arterial Hypertension is a publication on the Charles University in Prague. arterial hypertensionmorbiditymortalitypulmonarycharles https://research-portal.st-andrews.ac.uk/en/publications/population-geography-migration-and-inequalities-in-mortality-and-/ Population geography: migration and inequalities in mortality and morbidity - University of St... inequalities in mortalityuniversity ofpopulationgeographymigration https://pubmed.ncbi.nlm.nih.gov/24074811/?dopt=Abstract Risk analysis and stratification of surgical morbidity after immediate breast reconstruction Surgical complications after IBR are related to preoperatively identifiable factors that can be used to accurately risk stratify patients, which may assist... risk analysisstratification https://questioning-answers.blogspot.com/2015/05/psychological-morbidity-of-coeliac-disease.html?m=1 Questioning Answers: Psychological morbidity of coeliac disease A blog post discussing research reviewing the various psychological comorbidity associated with coeliac disease questioninganswerspsychologicalmorbiditycoeliac https://pure.psu.edu/en/publications/associations-between-preterm-birth-small-for-gestational-age-and-/ Associations between preterm birth, small-for-gestational age, and neonatal morbidity and cognitive... small for gestational agepreterm birth https://ja.dh.duke.edu/neurosurgery-academic-day---fy19/content/neurosurgery-academic-day-fy19-morbidity-mortality-11 Neurosurgery Academic Day - FY19 - Morbidity & Mortality | DUKEHealth JA academic dayneurosurgerymorbiditymortalityja https://www.scirp.org/journal/paperinformation?paperid=135702 Donor-Site Morbidity Following Harvest of Autologous Costal Cartilage in Microtia Reconstruction Objectives: The objective of this study is to evaluate donor-site morbidity after costal cartilage harvest for microtia reconstruction. Methods: A total of 70... autologous costal cartilage https://cordis.europa.eu/project/id/101065876/results/it Drivers of spatiotemporal variation in temperature-related morbidity and mortality in Europe:... Deliverables, publications, datasets, software, exploitable results morbidity and mortalitydriversvariation https://experts.arizona.edu/en/publications/ozone-and-cause-specific-cardiorespiratory-morbidity-and-mortalit/ Ozone and cause-specific cardiorespiratory morbidity and mortality - University of Arizona university ofozonecausespecificcardiorespiratory https://scholars.uky.edu/es/publications/protection-of-rabbits-against-colonization-and-morbidity-associat/ Protection of Rabbits Against Colonization and Morbidity Associated With Toxigenic Pasteurella... associated withprotectionrabbitscolonization