Robuta

https://www.sciencedaily.com/releases/2014/10/141014083836.htm Parkinson's: How toxic proteins stress nerve cells | ScienceDaily Parkinson's Disease is the second most common neurodegenerative disorder. The focus of the disease is the progressive degeneration of dopamine-producing nerve... parkinson snerve cellstoxicproteinsstress https://www.sciencenews.org/article/nerve-cells-als-patients-harbor-virus Nerve cells of ALS patients harbor virus Aug 8, 2019 - Fragments of viral genetic material show up with unusually high frequency in nerve tissue of patients with ALS, or Lou Gehrig's disease, suggesting a link... nerve cellsalspatientsharborvirus https://www.sciencedaily.com/releases/2004/07/040714090919.htm Nerve Cells' Powerhouse 'Clogged' In Lou Gehrig's Disease | ScienceDaily lou gehrig s diseasenerve cellspowerhousecloggedsciencedaily https://www.medicaldaily.com/same-nerve-cells-link-cause-burning-pain-and-itching-234192 Same nerve cells link cause burning pain and itching Nov 5, 2010 - Researchers say they have found a link in the nerve that could give an insight on what causes itching and why scratching relieves itching. nerve cellscauseburningpainitching https://www.news-medical.net/news/20250711/Researchers-create-over-400-types-of-nerve-cells-from-stem-cells.aspx Researchers create over 400 types of nerve cells from stem cells Jul 11, 2025 - Nerve cells are not just nerve cells. Depending on how finely we distinguish, there are several hundred to several thousand different types of nerve cell in... over 400types ofnerve cellsresearcherscreate https://www.uchicagomedicine.org/forefront/biological-sciences-articles/silicon-nanowires-let-scientists-control-nerve-cells-with-light Nanowires let scientists control nerve cells with light - UChicago Medicine Researchers have developed a way to use light-sensitive nanowires made of microscopic snippets of silicon and gold to control the activity of neurons. nerve cellswith lightnanowiresletscientists https://www.uab.edu/news/research-innovation/specific-trigeminal-sensory-nerve-cells-inhibition-presents-potential-treatment-pathway-for-craniofacial-pain-caused-by-mechanical-allodynia Specific trigeminal sensory nerve cells inhibition presents potential treatment pathway for... UAB researchers identify specific trigeminal sensory neurons driving mechanical allodynia, revealing how targeted inhibition of pain-signaling afferents and... sensory nervetreatment pathwayspecifictrigeminalcells https://www.sciencenews.org/article/outmuscled-muscles-not-nerve-cells-fail-old-worms Outmuscled: Muscles, not nerve cells, fail in old worms Jun 12, 2023 - In aging worms, the nervous system stays intact but muscles don't. nerve cellsmusclesfailoldworms https://www.sciencedaily.com/releases/2008/08/080828084056.htm Antidepressants Need New Nerve Cells To Be Effective, Researchers Find | ScienceDaily Researchers have discovered in mice that the brain must create new nerve cells for either exercise or antidepressants to reduce depression-like behavior. nerve cellsto beantidepressantsneednew https://www.sciencedaily.com/releases/2008/03/080313185753.htm New Drug Protects Nerve Cells From Damage In Mice | ScienceDaily Individuals with multiple sclerosis develop progressive neurological disability that is thought to be caused by degradation of nerve cells. A new study has... new drugnerve cellsprotectsdamagemice https://www.mpg.de/24787861/0526-neur-newly-identified-group-of-nerve-cells-in-the-brain-regulates-bodyweight-153735-x?c=153774 Nerve cells in the brain regulates bodyweight | Max-Planck-Gesellschaft Researchers identify group of nerve cells in the brain that influence eating behavior and weight gain in the brainnerve cellsmax planckbodyweightgesellschaft https://www.wikidata.org/wiki/Q72908467 Microelectrode determination of the intracellular chloride concentration in nerve cells - Wikidata scientific article published on 01 March 1966 of thenerve cellsmicroelectrodedeterminationintracellular https://www.mpg.de/15268319/neurons-mitochondrial-dysfunction Nerve cells with energy saving program | Max-Planck-Gesellschaft Thanks to a metabolic adjustment, the cells can remain functional despite damage to the mitochondria nerve cellsenergy savingmax planckprogramgesellschaft https://www.sciencenews.org/article/human-nerve-cell-rat-brain-organoi Clumps of human nerve cells thrived in rat brains Oct 12, 2022 - New results suggest that environment matters for the development of cerebral organoids, 3-D nerve cell clusters that grow and mimic the human brain. nerve cellsclumpshumanratbrains https://www.sciencenews.org/blog/science-ticker/insulating-sheath-nerve-cells-isnt-even-coat Insulating sheath on nerve cells isn't an even coat | Science News Myelin doesn't evenly coat axons, a finding that runs counter to what scientists suspected. nerve cells https://www.mpg.de/623051/pressRelease20100219?filter_order=L How nerve cells grow | Max-Planck-Gesellschaft nerve cellsmax planckgrowgesellschaft https://www.sciencenews.org/article/new-nerve-cells-adult-brains Signs of new nerve cells spotted in adult brains Aug 8, 2019 - A study finds new evidence that adult brains grow new nerve cells, even the brain of an octogenarian. nerve cellssignsnewspottedadult https://www.miragenews.com/shielding-nerve-cells-can-we-prevent-cell-death-1347565/ Shielding Nerve Cells: Can We Prevent Cell Death? | Mirage News LEUVEN October 31st - Alzheimer's disease is characterized by a progressive loss of nerve cells leading to a decline in memory and cognition. A team nerve cellscan weshieldingpreventdeath https://www.news-medical.net/news/2008/11/26/43480.aspx Defective calcium metabolism in nerve cells contributes to neurological disorder Jun 20, 2019 - Defective calcium metabolism in nerve cells may play a major role in a fatal genetic neurological disorder that resembles Huntington's disease, researchers at... calcium metabolismnerve cellsdefectivecontributesneurological https://www.sciencenews.org/article/itch-busting-nerve-cells-could-block-urge-scratch Itch-busting nerve cells could block urge to scratch Jun 12, 2023 - A group of nerve cells in the spinal cord keep mechanical itch in check. nerve cellsitchbustingcouldblock https://www.mpg.de/533238/pressRelease200601172 How Nerve Cells Stay in Shape | Max-Planck-Gesellschaft Max Planck researchers take a first look into the molecular processes that keep synapses in the correct form nerve cellsstay inmax planckshapegesellschaft https://www.sciencedaily.com/releases/2011/10/111018084434.htm Simple nerve cells regulate swimming depth of marine plankton | ScienceDaily As planktonic organisms the larvae of the marine annelid Platynereis swim freely in the open water. They move by activity of their cilia, thousands of tiny... nerve cellsmarine planktonsimpleregulateswimming https://www.sciencedaily.com/releases/2018/08/180824101204.htm Signaling cascade that repairs damaged nerve cells characterized | ScienceDaily Through a study of roundworm nerve cells with severed axons, researchers showed that a signaling cascade that normally functions in promoting the phagocytosis... signaling cascadenerve cellsrepairsdamagedsciencedaily https://www.nextbigfuture.com/2007/02/nanoparticles-light-interface-to-nerve.html Nanoparticles light interface to nerve cells | NextBigFuture.com Apr 7, 2017 - Nanoparticle integration with nerve cells and neurons nerve cellsnanoparticleslightinterface https://edubirdie.com/docs/seton-hall-university/psyc1219aa-sports-psychology/44926-kalat-ch-1-nerve-cells-and-nerve-impulses Kalat Ch. 1: Nerve Cells and Nerve Impulses - Edubirdie Kalat Ch. 1: Nerve Cells and Nerve Impulses Experience Neuropsychology of Religious Nerve Cells and Nerve Impulses 1.... Read more ch 1nerve cellskalatimpulsesedubirdie https://www.sciencenews.org/article/nerve-cells-ring-winter-olympics Nerve cells ring in the Winter Olympics Aug 8, 2019 - Scientists in Utah have sculpted living nerve cells into a microscopic version of the interlocking rings that symbolize the Olympic games. in the winternerve cellsringolympics https://www.mpg.de/8714391/migration-flrt-proteins Navigation for nerve cells | Max-Planck-Gesellschaft FLRT proteins direct precursors of pyramidal cells to their destination by attractant and repellent signals. navigation fornerve cellsmax planckgesellschaft https://www.princeton.edu/news/2006/04/20/researchers-find-nerve-cells-talk-pairs Researchers find nerve cells talk in pairs William Bialek and his research team have found that retinal ganglion cells, the nerve cells along the back of our eyes that transmit visual signals to the... nerve cellstalk inresearchersfindpairs https://www.dkfz.de/en/news/press-releases/detail/the-development-of-brain-stem-cells-into-new-nerve-cells-and-why-this-can-lead-to-cancer The development of brain stem cells into new nerve cells and why this can lead to cancer - German... Stem cells are true "Jacks-of-all-trades" of our bodies, as they can turn into the many different cell types of all organs. This allows the tissues such as... https://www.nyp.org/news/researchers-discover-possible-way-beta-amyloid-protein-kills-ner Researchers Discover Possible Way Beta-Amyloid Protein Kills Nerve Cells in Brains Affected by... Researchers from Weill Cornell Medical College and Columbia University College of Physicians Surgeons have discovered at least one way in which beta-amyloid,... https://www.science20.com/news_articles/cancer_drug_epothilone_causes_damaged_nerve_cells_in_spinal_cord_injuries_to_regrow-153980 Cancer Drug Epothilone Causes Damaged Nerve Cells In Spinal Cord Injuries To Regrow | Science 2.0 Damage to the spinal cord is often permanent because injured nerve cells fail to regenerate due to scar tissue of their long nerve fibers. Nerve cells are... https://pmc.ncbi.nlm.nih.gov/articles/PMC43363/ Polymer-encapsulated cells genetically modified to secrete human nerve growth factor promote the... Effective treatments for neurodegenerative disorders are limited by our inability to alter the progression of the diseases. A number of proteins have specific... https://www.sciencealert.com/cells-tasked-with-insulating-our-nerves-could-play-a-role-in-triggering-migraines We Just Got a Major Clue on How CGRP Contributes to Migraine in Our Nerve Cells : ScienceAlert Feb 4, 2022 - In the last few years, the deeply frustrating medical area of chronic migraine prevention has been revolutionized thanks to the discovery that a protein called... https://www.sciencedaily.com/releases/2009/01/090105175019.htm Nerve Cells In The Brain And Spinal Cord Sense Pain Caused By Physical Insult | ScienceDaily Researchers have shown that the protein COX2 in mouse nerve cells in the central nervous system (CNS) is crucial for hypersensitivity to pain caused by the... brain and spinal cord https://www.nhpr.org/2025-04-09/scientists-recreate-a-pathway-that-senses-pain-using-nerve-cells-grown-in-a-dish Scientists recreate a pathway that senses pain, using nerve cells grown in a dish | New Hampshire... Apr 9, 2025 - Scientists created a model of the human pain pathway in a dish by connecting four separate brain organoids. The feat should help them understand sensory... https://www.uni-wuerzburg.de/en/rvz/rvz-news/single/news/neue-methode-macht-maskierte-proteine-in-nervenzellen-sichtbar/ New method makes masked proteins in nerve cells visible - Rudolf Virchow Center for Integrative and... An international team of scientists developed a new method and visualized specific receptor proteins in nerve cells that are important for learning. The... https://www.ama-assn.org/about/awards/use-nerve-cells-improve-chd-post-surgery-neurological-deficits The use of nerve cells to improve CHD post-surgery neurological deficits | American Medical... In this episode, Alice Chen, a 2023 AMA Research Challenge finalist, covers her research on mesenchymal stromal cell delivery through cardiopulmonary bypass. https://www.dkfz.de/en/news/press-releases/detail/childhood-brain-tumors-develop-early-in-highly-specialized-nerve-cells Childhood brain tumors develop early in highly specialized nerve cells - German Cancer Research... Medulloblastomas, childhood brain tumors in children, are thought to develop between the first trimester of pregnancy and the end of the first year of life.... childhood brain tumors https://www.sciencedaily.com/releases/2015/05/150511172532.htm Bioprinting in 3-D: Looks like candy, could regenerate nerve cells | ScienceDaily Researchers are working on 3-D bioprinting synthetic tissue that could help regenerate nerve cells in patients with spinal cord injuries. in 3 d https://www.sciencenews.org/article/stem-cell-surprise-blood-cells-form-liver-nerve-cells Stem Cell Surprise: Blood cells form liver, nerve cells Jun 12, 2023 - Human blood contains stem cells that can be transformed outside the body into a variety of cell types, suggesting that a person's blood could someday provide... stem cellblood cellssurpriseformliver https://www.sciencedaily.com/releases/2004/08/040817080102.htm Nerve Cells 'Guided' To Repair Spinal Damage: Technique May Lead To Treatment For Severed Spinal... University of Toronto researchers have designed a method to facilitate nerve cell repair that could ultimately lead to treating severed spinal cords. https://www.sciencealert.com/scientists-succeed-in-regenerating-optic-nerve-cells-in-a-dish-hoping-it-leads-to-future-glaucoma-treatment Scientists Just Successfully Regenerated Mouse Optic Nerve Cells in The Lab : ScienceAlert Nov 6, 2020 - Scientists have found a new way to regenerate damaged optic nerve cells taken from mice and grown in a dish. in the laboptic nerve https://www.omicsonline.org/peer-reviewed/lowfrequency-whole-body-vibration-induced-neurite-outgrowth-by-pc12m3cells-with-impaired-nerve-growth-factorinduced-neurite-outgro-37262.html Low-Frequency, Whole Body Vibration Induced Neurite Outgrowth by Pc12m3 Cells with Impaired Nerve... Low-Frequency, Whole Body Vibration Induced Neurite Outgrowth by Pc12m3 Cells with Impaired Nerve Growth Factor-Induced Neurite Outgrowth Abstract. https://www.sciencedaily.com/releases/2013/06/130614082504.htm A turbocharger for nerve cells: Key mechanism boosts the signaling function of neurons in brain |... Locating a car that's blowing its horn in heavy traffic, channel-hopping between football and a thriller on TV without losing the plot, and not forgetting the... https://www.sciencedaily.com/releases/2005/03/050309135313.htm Molecular Messengers Perform A Crucial Role In The Ability Of Injured Nerve Cells To Heal... Long distance messengers star in many heroic tales, perhaps the most famous being the one about the runner who carried the news about the victory of the Greeks... https://www.sciencetimes.com/articles/45161/20230731/specific-nerve-cells-brain-completely-stop-forms-body-movements-study.htm Specific Nerve Cells in the Brain Can Completely Stop All Forms of Body Movements, Study Reveals Jul 31, 2023 - Scientists have discovered the remarkable ability of a group of nerve cells to completely stop movement in the body, even breathing. Learn more about them in... https://www.wikidata.org/wiki/Q36790346 Processing and secretion of nerve growth factor: expression in mammalian cells with a vaccinia... scientific article published on June 1, 1988 https://www.wikidata.org/wiki/Q58939827 Resting and Action Potentials of Reversed Polarity in Frog Nerve Cells - Wikidata scientific article published in Nature and actionreversed polarity https://www.nyp.org/news/plaques-in-brains-of-alzheimers-patients-may-originate-inside-th Plaques in Brains of Alzheimer's Patients May Originate Inside the Nerve Cells, Not Outside,... Ever since the German doctor Alois Alzheimer gave his name to the dementia suffered by many of the aging, nearly a century ago, it has been known that the... https://neurosciencenews.com/gut-brain-neurogenesis-18831/ Gut Microbe Secreted Molecule Linked to Formation of New Nerve Cells in Adult Brain - Neuroscience... Jun 28, 2021 - Gut microbes that metabolize tryptophan secrete indoles that stimulate the development of new neurons in the adult brain. https://www.sfn.org/publications/latest-news/2007/05/04/antidepressants-stimulate-creation Society for Neuroscience - ANTIDEPRESSANTS STIMULATE CREATION OF NEW NERVE CELLS IN ADULT MONKEYS;... society for neuroscience https://www.utsouthwestern.edu/newsroom/articles/year-2022/december-episodic-memory.html Flexible assemblies of nerve cells key to episodic memory: Newsroom - UT Southwestern, Dallas, Texas For the first time, scientists have recorded human nerve cells firing together in flexible assemblies, a process that appears necessary to successfully encode... https://www.sciencedaily.com/releases/2010/04/100401101101.htm Bone marrow cells produce nerve growth factor and promote angiogenesis around transplanted islets |... Islet transplantation is a promising treatment for type 1 diabetes mellitus. Clinical islet transplantation has not yielded long-term insulin-independence. One... bone marrow cellsnerve growth factor https://www.epo.org/fr/boards-of-appeal/decisions/t082034eu1 T 2034/08 (Nerve cells delivery compounds/ASILOMAR PHARMACEUTICALS, INC.) du 05.03.2009 https://www.frontiersin.org/journals/cellular-neuroscience/articles/10.3389/fncel.2019.00195/full Frontiers | Meningeal Mast Cells Contribute to ATP-Induced Nociceptive Firing in Trigeminal Nerve... Peripheral mechanisms of primary headaches such as migraine remain unclear. Meningeal afferents surrounded by multiple mast cells have been suggested as a ma... https://www.sciencedaily.com/releases/2018/03/180319120502.htm New method manages and stores data from millions of nerve cells -- in real time | ScienceDaily Recent developments in neuroscience set high requirements for sophisticated data management, not least when implantable Brain Machine Interfaces are used to... https://www.wikidata.org/wiki/Q52346124 Dependence of synaptic transmission on protein metabolism of nerve cells: a possible electrokinetic... scientific article published in June 1966 synaptic transmissionprotein metabolism https://www.wikidata.org/wiki/Q35062568 How to label nerve cells so that they can interconnect in an ordered fashion - Wikidata scientific article published on November 1, 1977 https://refractor.io/medical/red-light-therapy-spinal-cord-injury/ Spinal red-light therapy protects and regenerates damaged nerve cells May 7, 2024 - Applying red-light therapy to a damaged spinal cord protects and regenerates nerve cells, leading to a return of motor and sensory function, according to new... red light therapyspinalprotectsregeneratesdamaged https://www.wikidata.org/wiki/Q42200954 Stimulation of nerve growth factor mRNA content in C6 glioma cells by a beta-adrenergic receptor... scientific article published on January 1988 https://www.ucsf.edu/news/2003/03/97209/first-molecule-discovered-directs-nerve-cells-connect-each-other Archive: First molecule discovered that directs nerve cells to connect with each other | UC San...