https://www.winecollective.direct/region/wairarapa/alexia/wines/73654/Alexia-Tangent-Chenin-Blanc-2024
Buy the New Zealand wine Alexia Tangent Chenin Blanc 2024 750ml
Buy Alexia Tangent Chenin Blanc 2024 750ml wine from Alexia, New Zealand. Fully inclusive pricing delivered direct to your door
new zealand winechenin blancbuy
https://www.winecollective.direct/region/marlborough/wither-hills/wines/72070/Wither-Hills-Cellar-Collection-Rarangi-Riesling-2023
Buy the New Zealand wine Wither Hills Cellar Collection Rarangi Riesling 2023 750ml
Buy Wither Hills Cellar Collection Rarangi Riesling 2023 750ml wine from Wither Hills, New Zealand. Fully inclusive pricing delivered direct to your door
new zealand wine
https://winenz.com/worldwide-wine-delivery/
New Zealand Wine Delivery Worldwide
new zealand winedeliveryworldwide
https://www.winecollective.direct/region/otago/stewart-town-vineyard/wines/74668/Stewart-Town-Vineyard-The-Bounder-Pinot-Noir-2022
Buy the New Zealand wine Stewart Town Vineyard The Bounder Pinot Noir 2022 750ml
Buy Stewart Town Vineyard The Bounder Pinot Noir 2022 750ml wine from Stewart Town Vineyard, New Zealand. Fully inclusive pricing delivered direct to your door
new zealand wine
https://www.winecollective.direct/region/wairarapa/haythornthwaite-wines/wines/73262/Haythornthwaite-Wines-Estate-Pinot-Noir-2022
Buy the New Zealand wine Haythornthwaite Wines Estate Pinot Noir 2022 750ml
Buy Haythornthwaite Wines Estate Pinot Noir 2022 750ml wine from Haythornthwaite Wines, New Zealand. Fully inclusive pricing delivered direct to your door
new zealand wineestate pinot noir
https://www.winecollective.direct/region/marlborough/vavasour-wines/wines/72724/Vavasour-Papa-Pinot-Noir-2022
Buy the New Zealand wine Vavasour Papa Pinot Noir 2022 750ml
Buy Vavasour Papa Pinot Noir 2022 750ml wine from Vavasour Wines, New Zealand. Fully inclusive pricing delivered direct to your door
new zealand winepinot noirbuy
https://www.winecollective.direct/region/hawkes-bay/paritua-vineyards/wines/73409/Paritua-Stone-Paddock-Syrah-2024
Buy the New Zealand wine Paritua Stone Paddock Syrah 2024 750ml
Buy Paritua Stone Paddock Syrah 2024 750ml wine from Paritua Vineyards, New Zealand. Fully inclusive pricing delivered direct to your door
new zealand winebuy
https://www.wk.co.nz/about/case-studies/isabel-estate-business-case-study/
Isabel Estate | New Zealand Wine Case Study | WK Advisors & Accountant
new zealand winecase studyisabelestatewk
https://www.thevillagevine.co.uk/news/tag/new-zealand-wine-online
new zealand wine online | The Village Vine
new zealand winethe villageonlinevine
https://www.winecollective.direct/region/hawkes-bay/radburnd-cellars/wines/69919/Radburnd-Merlot-Cabernet-2020
Buy the New Zealand wine Radburnd Merlot Cabernet 2020 750ml
Buy Radburnd Merlot Cabernet 2020 750ml wine from Radburnd Cellars, New Zealand. Fully inclusive pricing delivered direct to your door
new zealand winebuymerlotcabernet
https://www.winecollective.direct/region/otago/carrick/wines/74906/Carrick-Bannockburn-Chardonnay-2018
Buy the New Zealand wine Carrick Bannockburn Chardonnay 2018 750ml
Buy Carrick Bannockburn Chardonnay 2018 750ml wine from Carrick, New Zealand. Fully inclusive pricing delivered direct to your door
new zealand winebuycarrickbannockburnchardonnay
https://www.winecollective.direct/region/wairarapa/te-kairanga-wines/wines/69615/Te-Kairanga-WPF-Pinot-Noir-2020
Buy the New Zealand wine Te Kairanga WPF Pinot Noir 2020 750ml
Buy Te Kairanga WPF Pinot Noir 2020 750ml wine from Te Kairanga Wines, New Zealand. Fully inclusive pricing delivered direct to your door
new zealand wine
https://www.winecollective.direct/wines/all-wines?ccm_paging_p=179&ccm_order_by=RAND()&ccm_order_by_direction=asc
Buy & Ship New Zealand Wine Direct to Your Door All Inclusive Pricing
Buy wines direct from the New Zealand producer. Direct to your door delivery. Our prices are fully inclusive of insurance, delivery and all taxes and charges....
new zealand wine
https://www.winecollective.direct/region/waiheke-island/wild-waiheke/wines/72507/Wild-Estate-Wanderlust--The-Reds--2022
Buy the New Zealand wine Wild Estate Wanderlust 'The Reds' 2022 750ml
Buy Wild Estate Wanderlust 'The Reds' 2022 750ml wine from Wild on Waiheke, New Zealand. Fully inclusive pricing delivered direct to your door
new zealand winebuy
https://www.tewksburyfinewine.com/wines/All/New-Zealand/2020/
2020 New Zealand Wine - Tewksbury Fine Wine & Spirits
new zealand winetewksburyfinespirits
https://www.winecollective.direct/region/otago/mount-edward-wines/wines/76613/Mount-Edward--Chardonnay-2025
Buy the New Zealand wine Mount Edward Chardonnay 2025 750ml
Buy Mount Edward Chardonnay 2025 750ml wine from Mount Edward Wines, New Zealand. Fully inclusive pricing delivered direct to your door
new zealand winebuymountedwardchardonnay
https://www.winecollective.direct/region/hawkes-bay/askerne-estate/wines/70267/Askerne-Noble-Kathryn-2020
Buy the New Zealand wine Askerne Noble Kathryn 2020 375ml
Buy Askerne Noble Kathryn 2020 375ml wine from Askerne Estate, New Zealand. Fully inclusive pricing delivered direct to your door
new zealand winebuynoblekathryn
https://www.highlandfinewine.com/wines/All/New-Zealand/?size=750
New Zealand Wine (750ml) - Highland Fine Wine
New Zealand Wine (750ml) - Highland Fine Wine. Search our inventory to find the best new zealand wine (750ml) at the best prices.
new zealand winehighlandfine
https://nzwinenav.com/tasting-panel/
Tasting Panel - New Zealand Wine Navigator
We only sell the wines we love to drink. We take this very seriously. Not only is every wine in our portfolio scored by our Master Sommelier, they are also...
new zealand winetasting panelnavigator
https://www.winecollective.direct/region/marlborough/fromm-winery/wines/72065/FROMM-Clayvin-Vineyard-Pinot-Noir-2022
Buy the New Zealand wine FROMM Clayvin Vineyard Pinot Noir 2022 750ml
Buy FROMM Clayvin Vineyard Pinot Noir 2022 750ml wine from Fromm Winery, New Zealand. Fully inclusive pricing delivered direct to your door
new zealand wine
https://www.winecollective.direct/region/greater-auckland/dancing-petrel/wines/65563/Dancing-Petrel-Viognier-Barrique-Reserve-Viognier-2021
Buy the New Zealand wine Dancing Petrel Viognier Barrique Reserve Viognier 2022 750ml
Buy Dancing Petrel Viognier Barrique Reserve Viognier 2022 750ml wine from Dancing Petrel, New Zealand. Fully inclusive pricing delivered direct to your door
new zealand wine
https://mail.wine.com.mt/wine/white/nau-mai-sauvignon-blanc-new-zealand
Nau Mai Sauvignon Blanc New Zealand | wine.mt
Vibrant elixir full of exquisite finesse and elegance only to be matched by its unbelievable flavor.
new zealand winesauvignon blancnaumaimt
https://webcastguru.app/event/clients/210922-010/
210922-010 - (New Zealand Wine) - Webcast Guru
new zealand winewebcastguru
https://www.winecollective.direct/region/marlborough/spy-valley-wines/wines/76397/Spy-Valley-E-Block-Sauvignon-Blanc-2023
Buy the New Zealand wine Spy Valley E Block Sauvignon Blanc 2023 750ml
Buy Spy Valley E Block Sauvignon Blanc 2023 750ml wine from Spy Valley Wines, New Zealand. Fully inclusive pricing delivered direct to your door
new zealand wine
https://www.winecollective.direct/region/otago/carrick/wines/72756/Carrick-Bannockburn-Sauvignon-Blanc-2023
Buy the New Zealand wine Carrick Bannockburn Sauvignon Blanc 2023 750ml
Buy Carrick Bannockburn Sauvignon Blanc 2023 750ml wine from Carrick, New Zealand. Fully inclusive pricing delivered direct to your door
new zealand winesauvignon blancbuy
https://www.winecollective.direct/region/marlborough/ant-moore-wines/wines/74038/Ant-Moore-a--Pinot-Noir-2023
Buy the New Zealand wine Ant Moore a+ Pinot Noir 2023 750ml
Buy Ant Moore a+ Pinot Noir 2023 750ml wine from Ant Moore Wine, New Zealand. Fully inclusive pricing delivered direct to your door
new zealand wine
https://www.winecollective.direct/region/otago/carrick/wines/67973/Carrick-Excelsior-1-5L-Magnum-Pinot-Noir-2016
Buy the New Zealand wine Carrick Excelsior 1.5L Magnum Pinot Noir 2016 1.5l
Buy Carrick Excelsior 1.5L Magnum Pinot Noir 2016 1.5l wine from Carrick, New Zealand. Fully inclusive pricing delivered direct to your door
new zealand wine
https://www.winecollective.direct/region/otago/waitiri-creek-wines/wines/67474/Waitiri-Creek-Drummer-Pinot-Noir-2019
Buy the New Zealand wine Waitiri Creek Drummer Pinot Noir 2020 750ml
Buy Waitiri Creek Drummer Pinot Noir 2020 750ml wine from Waitiri Creek Wines, New Zealand. Fully inclusive pricing delivered direct to your door
new zealand wine
https://rankers.co.nz/regions/hawkes-bay/pages/12
Hawke's Bay, New Zealand | Wine, Art Deco & Coast (Page 12)
Hawke's Bay is New Zealand's premier wine and food region, home to Art Deco Napier, Cape Kidnappers gannet colony, Te Mata Peak, and over 70 wineries across...
hawke s baynew zealand wineart deco
https://www.winecollective.direct/region/waiheke-island/poderi-crisci/wines/72134/Poderi-Crisci-Pinot-Grigio-Pinot-Gris-2023
Buy the New Zealand wine Poderi Crisci Pinot Grigio Pinot Gris 2023 750ml
Buy Poderi Crisci Pinot Grigio Pinot Gris 2023 750ml wine from Poderi Crisci, New Zealand. Fully inclusive pricing delivered direct to your door
new zealand wine
https://www.winecollective.direct/region/canterbury/torlesse-wines/wines/73229/Torlesse-Wines-Waipara-Pinot-Gris-2023
Buy the New Zealand wine Torlesse Wines Pinot Gris 2025 750ml
Buy Torlesse Wines Pinot Gris 2025 750ml wine from Torlesse Wines, New Zealand. Fully inclusive pricing delivered direct to your door
new zealand winepinot grisbuy
https://www.winecollective.direct/region/hawkes-bay/lime-rock-wines/wines/69366/Lime-Rock-Coquina-Sauvignon-Blanc-2020
Buy the New Zealand wine Lime Rock Coquina Sauvignon Blanc 2020 750ml
Buy Lime Rock Coquina Sauvignon Blanc 2020 750ml wine from Lime Rock Wines, New Zealand. Fully inclusive pricing delivered direct to your door
new zealand winelime rock
https://www.winecollective.direct/region/canterbury/melton-estate/wines/76518/Melton-Estate-Chardonnay-2025
Buy the New Zealand wine Melton Estate Chardonnay 2025 750ml
Buy Melton Estate Chardonnay 2025 750ml wine from Melton Estate, New Zealand. Fully inclusive pricing delivered direct to your door
new zealand wineestate chardonnaybuymelton
https://chanswineworld.com/shop/product/kumeu-river-coddington-vineyard-chardonnay-new-zealand/5f6b849cbaaf135b90dbaca6?option-id=db784bb29ba4729a6920ce6802dc55626145bfcc171f9311ee72871d829eb15b
Kumeu River Coddington Vineyard Chardonnay New Zealand - Wine World - Wine & Spirits
This wine is produced from a vineyard owned by Tim and Angela Coddington, whose grapes have contributed to the blend of Kumeu River Estate Chardonnay since...
new zealand winekumeu rivercoddingtonvineyardchardonnay
https://www.e-act.nl/ah/site?a=1112&p=519734
Aanmelden Australian and New Zealand Wine Tastings Amsterdam 2026
new zealand wineaanmeldenaustraliantastingsamsterdam
https://www.winecollective.direct/region/otago/rippon-vineyard/wines/75226/Rippon-Wanaka-Village-Pinot-Noir-2024
Buy the New Zealand wine Rippon Wanaka Village Pinot Noir 2024 750ml
Buy Rippon Wanaka Village Pinot Noir 2024 750ml wine from Rippon Vineyard, New Zealand. Fully inclusive pricing delivered direct to your door
wanaka village pinot noirnew zealand wine
https://www.winecollective.direct/region/marlborough/nautilus-estate/wines/71416/Nautilus-Southern-Valleys-Pinot-Noir-2022
Buy the New Zealand wine Nautilus Southern Valleys Pinot Noir 2022 750ml
Buy Nautilus Southern Valleys Pinot Noir 2022 750ml wine from Nautilus Estate, New Zealand. Fully inclusive pricing delivered direct to your door
new zealand wine
https://www.thebrookeblend.com/blog/tags/new-zealand-wine
new zealand wine | The Brooke Blend
new zealand winethe brookeblend
https://www.winecollective.direct/region/otago/wild-earth-wines/wines/75527/Wild-Earth-Wines-Pinot-Noir-2023
Buy the New Zealand wine Wild Earth Wines Pinot Noir 2023 750ml
Buy Wild Earth Wines Pinot Noir 2023 750ml wine from Wild Earth Wines, New Zealand. Fully inclusive pricing delivered direct to your door
new zealand winewild earth
https://nzwinepro.rezdy.com/416851/gift-voucher-nzd-100
Gift Voucher NZD$100 - New Zealand Wine Promotions Ltd Reservations
Rezdy Online Booking
new zealand winegift vouchernzdpromotionsltd
https://www.winecollective.direct/region/marlborough/whitehaven-wine-company/wines/74396/Whitehaven-Chardonnay-2024
Buy the New Zealand wine Whitehaven Chardonnay 2024 750ml
Buy Whitehaven Chardonnay 2024 750ml wine from Whitehaven Wines, New Zealand. Fully inclusive pricing delivered direct to your door
new zealand winebuywhitehavenchardonnay
https://www.wittyswine.com/websearch_results.html?item_type=wine&country=New+Zealand
New Zealand Wine - Witty's Fine Wine & Liquors
new zealand winewittyfineliquors
https://www.winecollective.direct/region/canterbury/straight-8-estate/wines/68781/Straight-Eight-Estate-Dry-Riesling-2022
Buy the New Zealand wine Straight Eight Estate Dry Riesling 2022 750ml
Buy Straight Eight Estate Dry Riesling 2022 750ml wine from Straight 8 Estate, New Zealand. Fully inclusive pricing delivered direct to your door
new zealand winestraight eight
https://woodfirefoodco.com/harmonizing-flavors-and-culture-a-culinary-prelude-to-new-zealands-wine-adventure/
New Zealand Wine Growers Association Kick Off Party - woodfirefoodco.com
Sep 27, 2023 - Wood Fire Food joins the New Zealand Wine Growers for an unforgettable kick off dinner party in Tivoli, New York.
new zealand winekick offgrowersassociationparty
https://winelegendcherryhill.com/shop/product/rongopai-sauvignon-blanc-marlborough-new-zealand/6111809af13ad73d2346bcc3?option-id=42434c8331bff7f58105ce4954e9fdbb84d35d9f0365310e50f16a3deeed0861
Rongopai Sauvignon Blanc Marlborough New Zealand - Wine Legend Cherry Hill, Cherry Hill, NJ, Cherry...
Rongopai Sauvignon Blanc tasting notes include aromas of tropical fruit, green apple, and citrus zest on the nose, with layers of passionfruit, fresh herbs,...
new zealand winesauvignon blanccherry hillmarlborough
https://www.winecollective.direct/region/wairarapa/margrain-vineyard/wines/76411/Margrain-Chenin-Blanc-2023
Buy the New Zealand wine Margrain Chenin Blanc 2023 750ml
Buy Margrain Chenin Blanc 2023 750ml wine from Margrain Vineyard, New Zealand. Fully inclusive pricing delivered direct to your door
new zealand winechenin blancbuy
https://rankers.co.nz/regions/hawkes-bay/filters/category~visitor-centres__location~waipukurau
Hawke's Bay, New Zealand | Wine, Art Deco & Coast
Hawke's Bay is New Zealand's premier wine and food region, home to Art Deco Napier, Cape Kidnappers gannet colony, Te Mata Peak, and over 70 wineries across...
hawke s baynew zealand wineart decocoast
https://www.winecollective.direct/region/hawkes-bay/askerne-estate/wines/72806/Askerne-Estate-Viognier-2023
Buy the New Zealand wine Askerne Estate Viognier 2023 750ml
Buy Askerne Estate Viognier 2023 750ml wine from Askerne Estate, New Zealand. Fully inclusive pricing delivered direct to your door
new zealand winebuyestateviognier
https://www.winecollective.direct/region/greater-auckland/soljans-estate-winery/wines/76611/Soljans-Estate-Winery-Barrique-Reserve-Pinotage-2025
Buy the New Zealand wine Soljans Estate Winery Barrique Reserve Pinotage 2025 750ml
Buy Soljans Estate Winery Barrique Reserve Pinotage 2025 750ml wine from Soljans Estate Winery, New Zealand. Fully inclusive pricing delivered direct to your...
new zealand wine
https://www.domainroad.co.nz/
Domain Road Vineyard - New Zealand Wine, Central Otago
new zealand winedomainroadvineyardcentral
https://www.winfieldflynn.com/wines/All/New-Zealand/2019/?price_band=10&item_type=wine
2019 New Zealand Wine Under $10 - Winfield Flynn
2019 New Zealand Wine Under $10 - Winfield Flynn. Search our inventory to find the best 2019 new zealand wine under $10 at the best prices.
new zealand winewinfieldflynn
https://www.winfieldflynn.com/wines/All/New-Zealand/2019/?country=New+Zealand&year=2019&sortby=year&l=25&item_type=wine
2019 New Zealand Wine - Winfield Flynn
2019 New Zealand Wine - Winfield Flynn. Search our inventory to find the best 2019 new zealand wine at the best prices.
new zealand winewinfieldflynn
https://www.winecollective.direct/region/wairarapa/blue-earth-estate/wines/70067/Blue-Earth-Estate-Pinot-Noir-2020
Buy the New Zealand wine Blue Earth Estate Pinot Noir 2020 750ml
Buy Blue Earth Estate Pinot Noir 2020 750ml wine from Blue Earth Estate, New Zealand. Fully inclusive pricing delivered direct to your door
new zealand wineestate pinot noirblue earth
https://www.winecollective.direct/region/otago/bald-hills-vineyard/wines/71488/Bald-Hills-Single-Vineyard-Pinot-Noir-2019
Buy the New Zealand wine Bald Hills Single Vineyard Pinot Noir 2019 750ml
Buy Bald Hills Single Vineyard Pinot Noir 2019 750ml wine from Bald Hills Wines, New Zealand. Fully inclusive pricing delivered direct to your door
new zealand wine
https://www.nzwine.com/en/visit/play/?page=7
Play: New Zealand Wine Experiences | New Zealand Wine
Find wineries offering vineyard and winery tours, plus other unique wine experiences and activities
new zealand wineplayexperiences
https://www.blackhorseptbo.com/event-details/france-vs-new-zealand-wine-tasting-2nd-seating
France vs New Zealand Wine Tasting 2nd Seating | The Black Horse
Old World vs New World Match up!
new zealand winethe blackfrancevs
https://www.winecollective.direct/region/marlborough/nautilus-estate/wines/74656/Nautilus-Pinot-Gris-2025
Buy the New Zealand wine Nautilus Pinot Gris 2025 750ml
Buy Nautilus Pinot Gris 2025 750ml wine from Nautilus Estate, New Zealand. Fully inclusive pricing delivered direct to your door
new zealand winepinot grisbuynautilus
https://www.winecollective.direct/region/hawkes-bay/stonecroft/wines/74151/Stonecroft-Gimblett-Gravels-Zinfandel-2023
Buy the New Zealand wine Stonecroft Gimblett Gravels Zinfandel 2023 750ml
Buy Stonecroft Gimblett Gravels Zinfandel 2023 750ml wine from Stonecroft, New Zealand. Fully inclusive pricing delivered direct to your door
new zealand winebuy
https://vinabonus.com/
New Zealand wine import - vinabonus GmbH
Wine imports from New Zealand for trade, restaurants and hotels. Discover a wide range of excellent New Zealand wines that bring extra value to your customers.
new zealand wineimportgmbh
https://theworldofwhisky.com/en/limitirani-izdaniya/vino/vinultra-riesling-little-beauty-limited-edition-marlborough-new-zealand.html
Vinultra Riesling LITTLE BEAUTY Limited Edition, Marlborough, New Zealand - WINE | The World of...
Little Beauty - line of exclusive wines come from the valley Waihopai which fully reveal the tradition of New Zealand In English the little beauty - little...
new zealand wine
https://www.winemerchantcincinnati.com/websearch_results.html?page=1&country=New+Zealand&price_band=25&year=2022&sortby=winery&l=25&item_type=wine
2022 New Zealand Wine between $10 and $25 - The Wine Merchant - Cincinnati, OH
2022 New Zealand Wine between $10 and $25 - The Wine Merchant - Cincinnati, OH. Search our inventory to find the best 2022 new zealand wine between $10 and $25...
new zealand wine
https://www.winecollective.direct/region/marlborough/hans-herzog-estate/wines/74484/Hans-Herzog--Merlot-2019
Buy the New Zealand wine Hans Herzog Merlot 2019 750ml
Buy Hans Herzog Merlot 2019 750ml wine from Hans Herzog Estate, New Zealand. Fully inclusive pricing delivered direct to your door
new zealand winebuyhansherzogmerlot
https://www.bottlesandcases.com/wines/All/New-Zealand/
New Zealand Wine - Bottles and Cases
New Zealand Wine - Bottles and Cases. Search our inventory to find the best new zealand wine at the best prices.
new zealand winebottlescases
https://www.mickyfinns.com/websearch_results.html?item_type=wine&country=New+Zealand
New Zealand Wine - Micky Finn's
New Zealand Wine - Micky Finn's. Search our inventory to find the best new zealand wine at the best prices.
new zealand winemickyfinn
https://www.winecollective.direct/region/marlborough/whitehaven-wine-company/wines/75507/Whitehaven-Late-Harvest-Noble-Riesling-2023
Buy the New Zealand wine Whitehaven Late Harvest Noble Riesling 2023 375ml
Buy Whitehaven Late Harvest Noble Riesling 2023 375ml wine from Whitehaven Wines, New Zealand. Fully inclusive pricing delivered direct to your door
new zealand wine
https://triciawinewanderings.substack.com/p/new-zealand-wine-packs-a-punch?open=false
New Zealand Wine Packs a Punch - by Tricia Conover
Celebrating NZ Wine Week, 2023
new zealand winepackspunchtriciaconover
https://www.rankers.co.nz/regions/hawkes-bay/pages/2
Hawke's Bay, New Zealand | Wine, Art Deco & Coast (Page 2)
Hawke's Bay is New Zealand's premier wine and food region, home to Art Deco Napier, Cape Kidnappers gannet colony, Te Mata Peak, and over 70 wineries across...
hawke s baynew zealand wineart deco
https://www.winecollective.direct/region/marlborough/jackson-estate/wines/68591/Jackson-Estate-Vintage-Widow-Pinot-Noir-2019
Buy the New Zealand wine Jackson Estate Vintage Widow Pinot Noir 2019 750ml
Buy Jackson Estate Vintage Widow Pinot Noir 2019 750ml wine from Jackson Estate, New Zealand. Fully inclusive pricing delivered direct to your door
new zealand wine
https://montecristomagazine.com/tag/new-zealand-wine
New Zealand Wine Archives - MONTECRISTO | MONTECRISTO
new zealand winearchivesmontecristo
https://www.newzealands.co.nz/category/new-zealand-wine-vineyard-tours/
New Zealand Wine & Vineyard Tours Archives - Welcome to New Zealand | Free Travel and Tourism...
Explore exquisite New Zealand wine and vineyard tours. Discover world-class wineries, stunning landscapes, and unique flavors. Book your adventure today!
new zealand winevineyard tours
https://www.winecollective.direct/region/greater-auckland/cable-bay-wine/wines/76496/Cable-Bay-Awatere-Valley-Pinot-Gris-2024
Buy the New Zealand wine Cable Bay Awatere Valley Pinot Gris 2024 750ml
Buy Cable Bay Awatere Valley Pinot Gris 2024 750ml wine from Cable Bay Wine, New Zealand. Fully inclusive pricing delivered direct to your door
new zealand wine
https://www.winecollective.direct/wines/all-wines?ccm_paging_p=3&ccm_order_by=RAND()&ccm_order_by_direction=asc
Buy & Ship New Zealand Wine Direct to Your Door All Inclusive Pricing
Buy wines direct from the New Zealand producer. Direct to your door delivery. Our prices are fully inclusive of insurance, delivery and all taxes and charges....
new zealand wine
https://www.winecollective.direct/region/marlborough/esses-wine-company/wines/76542/Esses-Coalescence-Sparkling-2018
Buy the New Zealand wine Esses Coalescence Sparkling 2018 750ml
Buy Esses Coalescence Sparkling 2018 750ml wine from Esses Wine Company, New Zealand. Fully inclusive pricing delivered direct to your door
new zealand winebuycoalescencesparkling
https://www.neuseeland-weinboutique.de/en/wine-regions/nelson
Wines from New Zealand wine region Nelson
Wine regions in New Zealand - Nelson: Explore wine from New Zealand grown in Nelson.
from new zealandwine regionwinesnelson
https://www.rankers.co.nz/regions/wairarapa/filters/category~air-transport__location~martinborough
Wairarapa, New Zealand | Wine, Heritage & Coastal Scenery
Wairarapa is a wine and rural region 90 minutes from Wellington, known for Pinot Noir, Victorian heritage towns, Cape Palliser's coastline, and the Remutaka...
new zealand winewairarapaheritagecoastalscenery
https://www.winecollective.direct/region/waiheke-island/kennedy-point-vineyard/wines/69874/Kennedy-Point-Reserve-Syrah-2020
Buy the New Zealand wine Kennedy Point Reserve Syrah 2020 750ml
Buy Kennedy Point Reserve Syrah 2020 750ml wine from Kennedy Point Vineyard, New Zealand. Fully inclusive pricing delivered direct to your door
new zealand winebuy
https://www.theicehouse.co.nz/blog/new-zealand-wine-icehouse-scholarships-the-business-of-growing
New Zealand Wine Icehouse Scholarships - The business of growing
NZ Wine and Xero are offering five $1,000 scholarships for Taking Your Business Forward. This article first appeared in New Zealand Winegrower Magazine.
new zealand winethe businessicehousescholarshipsgrowing
https://www.wittyswine.com/wines/All/New-Zealand
New Zealand Wine - Witty's Fine Wine & Liquors
new zealand winewittyfineliquors
https://nzwinepro.rezdy.com/
New Zealand Wine Promotions Ltd Reservations
Rezdy Online Booking
new zealand winepromotionsltdreservations
https://www.winecollective.direct/region/hawkes-bay/church-road/wines/74094/Church-Road-Editions---Cabernet-Franc-2023
Buy the New Zealand wine Church Road Editions - Cabernet Franc 2023 750ml
Buy Church Road Editions - Cabernet Franc 2023 750ml wine from Church Road, New Zealand. Fully inclusive pricing delivered direct to your door
new zealand winechurch road
https://bottle-stop.com.au/collections/new-zealand-wine
New Zealand Wine | Buy New Zealand Wine Online | Bottle Stop
New Zealand wines offer some truly world-class experiences, especially in their Sauvignon Blancs. At Bottle Stop we have many of these available in our online...
new zealand winebuy onlinebottlestop
https://www.winecollective.direct/region/marlborough/eva-pemper/wines/76482/Eva-Pemper-Single-Vineyard-Sauvignon-Blanc-2024
Buy the New Zealand wine Eva Pemper Single Vineyard Sauvignon Blanc 2024 750ml
Buy Eva Pemper Single Vineyard Sauvignon Blanc 2024 750ml wine from Eva Pemper, New Zealand. Fully inclusive pricing delivered direct to your door
new zealand wine
https://www.winecollective.direct/region/wairarapa/escarpment-winery/wines/67350/Escarpment-Martinborough-Pinot-Noir-2022
Buy the New Zealand wine Escarpment Martinborough Pinot Noir 2023 750ml
Buy Escarpment Martinborough Pinot Noir 2023 750ml wine from Escarpment Winery, New Zealand. Fully inclusive pricing delivered direct to your door
new zealand winepinot noirbuy
https://www.winecollective.direct/region/canterbury/pegasus-bay-winery/wines/67831/Pegasus-Bay-ENCORE-Noble-Riesling-2025
Buy the New Zealand wine Pegasus Bay ENCORE Noble Riesling 2025 375ml
Buy Pegasus Bay ENCORE Noble Riesling 2025 375ml wine from Pegasus Bay Winery, New Zealand. Fully inclusive pricing delivered direct to your door
new zealand wine
https://www.winecollective.direct/region/waiheke-island/poderi-crisci/wines/72131/Poderi-Crisci-Arneis-2023
Buy the New Zealand wine Poderi Crisci Arneis 2024 750ml
Buy Poderi Crisci Arneis 2024 750ml wine from Poderi Crisci, New Zealand. Fully inclusive pricing delivered direct to your door
new zealand winebuyarneis
https://nzwinepro.rezdy.com/185930/matakana-scenic-coastal-getaway-tour?lang=nb
Matakana Scenic Coastal Getaway Tour - New Zealand Wine Promotions Ltd Reservations
Rezdy Online Booking
tour new zealandcoastal getawaymatakanascenic
https://www.winecollective.direct/region/marlborough/cloudy-bay/wines/75636/Cloudy-Bay-Founders--Cellar-Unoaked-Chardonnay-2024
Buy the New Zealand wine Cloudy Bay Founders' Cellar Unoaked Chardonnay 2024 750ml
Buy Cloudy Bay Founders' Cellar Unoaked Chardonnay 2024 750ml wine from Cloudy Bay, New Zealand. Fully inclusive pricing delivered direct to your door
new zealand wine
https://www.bottlebargains.com/websearch_results.html?country=New+Zealand&size=1500&sortby=winery&l=25&item_type=wine
New Zealand Wine Magnums - BottleBargains
New Zealand Wine Magnums - BottleBargains. Search our inventory to find the best new zealand wine magnums at the best prices.
new zealand winemagnums
https://www.winecollective.direct/region/hawkes-bay/ash-ridge-wines/wines/71266/Ash-Ridge-Wines-Elodie-Bubbles-Sparkling-2025
Buy the New Zealand wine Ash Ridge Wines Elodie Bubbles Sparkling 2025 750ml
Buy Ash Ridge Wines Elodie Bubbles Sparkling 2025 750ml wine from Ash Ridge Wines, New Zealand. Fully inclusive pricing delivered direct to your door
new zealand wine
https://www.winewatch.com/wine-shop-d2/cabernet-sauvignon-c9/2010-stonyridge-vineyard-larose-waiheke-island-new-zealand-p39716/
2010 Stonyridge Vineyard Larose, Waiheke Island, New Zealand - Wine Watch
2010 Stonyridge Vineyard Larose, Waiheke Island, New Zealand - Vineyard notes: "Gentle north-facing slopes of Waiheke Island shelter us from the cool southerly...
new zealand winewaiheke islandvineyardlarosewatch
https://www.newzealandselfdrivetours.co.nz/food-and-wine
New Zealand Wine & Food Tours | Tailor Made Self Drive Packages
Enjoy a New Zealand tour featuring food and wine experiences. Talk to a New Zealand Self Drive Tours consultant about a tailor made self drive holiday or food...
new zealand winefood tourstailor madeself drivepackages
https://www.winecollective.direct/region/waiheke-island/te-motu-vineyard/wines/63425/Te-Motu-Cab-Sav-Merlot-Franc-2015
Buy the New Zealand wine Te Motu Cab Sav Merlot Franc 2015 750ml
Buy Te Motu Cab Sav Merlot Franc 2015 750ml wine from Te Motu Vineyard, New Zealand. Fully inclusive pricing delivered direct to your door
new zealand wine
https://www.winetraveler.com/destinations/new-zealand/
New Zealand Wine Travel Guides, Itineraries & Articles 2026
new zealand winetravel guidesitinerariesarticles
https://www.winecollective.direct/
Buy & Ship New Zealand Wine | Wine Collective Direct
new zealand winebuyshipcollectivedirect
https://www.virginiaphilipwineandspirits.com/websearch_results.html?item_type=wine&country=New+Zealand
New Zealand Wine - Virginia Philip Wine Spirits & Academy
new zealand winevirginiaphilipspiritsacademy
https://winetoursaustralia-nz.com/
Australia & New Zealand Wine Tours
australia new zealandwinetours
https://www.winesfrommartinborough.com/
Ultimate New Zealand Wine Guide: History, Types, and More - Winesfrommartinborough.com
In this New Zealand wine guide, find out the history of wine in the Pacific island, the wine varieties and styles, wine growing regions and more.
ultimate new zealandwine guide
https://www.winecollective.direct/region/marlborough/wairau-river-wines/wines/76567/Wairau-River-Estate-Chardonnay-2025
Buy the New Zealand wine Wairau River Estate Chardonnay 2025 750ml
Buy Wairau River Estate Chardonnay 2025 750ml wine from Wairau River Wines, New Zealand. Fully inclusive pricing delivered direct to your door
new zealand wineestate chardonnaybuy
https://www.rankers.co.nz/regions/hawkes-bay/filters/category~land-activities__location~napier
Hawke's Bay, New Zealand | Wine, Art Deco & Coast
Hawke's Bay is New Zealand's premier wine and food region, home to Art Deco Napier, Cape Kidnappers gannet colony, Te Mata Peak, and over 70 wineries across...
hawke s baynew zealand wineart decocoast
https://www.winecollective.direct/region/hawkes-bay/alpha-domus/wines/70988/Alpha-Domus-The-Aerofoil-Cabernet-Sauvignon-2021
Buy the New Zealand wine Alpha Domus The Aerofoil Cabernet Sauvignon 2021 750ml
Buy Alpha Domus The Aerofoil Cabernet Sauvignon 2021 750ml wine from Alpha Domus, New Zealand. Fully inclusive pricing delivered direct to your door
new zealand wine