https://www.equipmentfa.com/news/31464/ecapital-names-sheppard-as-chief-operating-officer
eCapital Names Sheppard as Chief Operating Officer - News | Equipment Finance Advisor
eCapital Corp, a leading alternative finance provider in North America, announced that Charles Sheppard, formerly President of the eCapital Freight Factoring...
chief operating officerequipment financeecapitalnamessheppard
https://theorg.com/org/boodmo/org-chart/swayam-jaiswal
Swayam Jaiswal - Chief People & Operating Officer at boodmo | The Org
Swayam Jaiswal has been working in the Human Resources field since 2012.
operating officerswayamchiefpeopleboodmo
https://matthewlucas.com/
Matthew Lucas - Digital Marketer, Chief Operating Officer, Startup Mentor
Matthew Lucas, a leader in Digital Marketing and Startup business since the 1990's is also an active private equity investor and is involved with over twenty...
chief operating officerdigital marketermatthewlucasstartup
https://brandequity.economictimes.indiatimes.com/news/the-people-report/netcore-cloud-appoints-siddharth-gopalkrishnan-as-chief-operating-officer/113621962
Netcore Cloud appoints Siddharth Gopalkrishnan as chief operating officer, ETBrandEquity
Siddharth Gopalkrishnan: An IIM Bangalore alumnus, Gopalkrishnan brings over 16 years of experience from McKinsey, where he led transformative digital...
chief operating officernetcore cloudsiddharth
https://thesoul.group/blog/thesoul-elevates-aleksandra-sulimko-to-chief-operating-officer
TheSoul Elevates Aleksandra Sulimko to Chief Operating Officer - My Framer Site
TheSoul Publishing announces an exciting leadership transition.
chief operating officeraleksandra sulimko
https://www.innovatefinance.com/profiles/patrick-mccann/
Patrick McCann | Chief Operating Officer, Kompli-Global
Jun 4, 2021 - Patrick has spent the last 20 years consulting to SMEs in the property, telecoms, commercial insurance and financial services sectors. Previous roles
chief operating officerpatrickmccannglobal
https://mytravelr.com/abhishek-sharma-appointed-chief-operating-officer-coo-at-soneva-group-dubai/
Abhishek Sharma appointed Chief Operating Officer (COO) at Soneva Group Dubai | mytravelr
chief operating officerabhishek sharma
https://www.theemmesgroup.com/news/wendy-buckland-join-emmes-chief-operating-officer
Wendy Buckland to Join Emmes as Chief Operating Officer | Emmes Group
chief operating officerwendybucklandjoinemmes
https://www.metro-magazine.com/news/denver-rtd-names-new-chief-operating-officer
Denver RTD names new chief operating officer | Metro
Mar 3, 2018 - Michael Ford will take over the new position and oversee the assistant general managers of rail operations and bus operations.
chief operating officerdenver rtdnamesnewmetro
https://jobs.glynncapital.com/companies/stripe/jobs/66345440-chief-operating-officer-coo-deputy-trust-officer-bridge
Chief Operating Officer (COO) & Deputy Trust Officer, Bridge @ Stripe | Glynn Capital Job Board
Search job openings across the Glynn Capital network.
chief operating officer
https://www.builtinnyc.com/articles/spark-advisors-hires-new-coo-20260304
Spark Advisors Appoints New Chief Operating Officer | Built In NYC
Pooneet Kant joins with over a decade of leadership experience in relationship-based industries.
chief operating officersparkadvisorsnewbuilt
https://techmins.com/apple-announces-chief-operating-officer-transition/
Apple announces chief operating officer transition - Newest Tech Trends
Jul 9, 2025 - July 8, 2025 PRESS RELEASE Apple announces chief operating officer transition CUPERTINO, CALIFORNIA Apple today announced Jeff Williams will transition his...
chief operating officerappleannouncestransitionnewest
https://www.finanznachrichten.de/nachrichten-2026-04/68244735-bristow-group-announces-planned-retirement-of-chief-operating-officer-government-services-008.htm
Bristow Group Announces Planned Retirement of Chief Operating Officer, Government Services
HOUSTON, April 20, 2026 /PRNewswire/ -- Bristow Group Inc., (NYSE: VTOL), the global leader in innovative and sustainable vertical flight solutions, today...
chief operating officerbristowgroupannouncesplanned
https://www.oxinst.jp/news/ian-barkshire,-chief-operating-officer,-to-succeed-jonathan-flint-as-chief-executive/
Ian Barkshire, Chief Operating Officer, to succeed Jonathan Flint as Chief Executive -...
chief operating officerian
https://jobs.appcast.io/uchealth/chief-operating-officer-medical-group/55593271837
Chief Operating Officer Medical Group @ UC Health
Chief Operating Officer Medical Group job @ UC Health in Lakewood, CO
chief operating officermedical groupuchealth
https://www.maximrecruitment.com/chief-operating-officer-job-dubai-united-arab-emirates-10124
Chief Operating Officer job in Dubai, United Arab Emirates (MAX10124) - Maxim Recruitment
Our client, a boutique multi award winning progressive architectural practice is looking to appoint a very high calibre strategic Chief Operating Officer to...
chief operating officerunited arab emirates
https://www.exaqueo.com/team/lexi-gordon
Lexi Gordon - Chief Operating Officer, exaqueo
Lexi Gordon is the Chief Operating Officer at exaqueo, overseeing our consulting operations and company growth. This means leading our team through the "how"...
chief operating officerlexigordon
https://sqitconsulting.com/author/pawan-gautam/
Co-Founder and Chief Operating Officer| Microsoft Certified Consultant
With 12+ years of experience as a Microsoft Certified Dynamics 365 Consultant, including my role as COO and Co-founder, I've led over 30+ end-to-end...
chief operating officerco foundermicrosoft certifiedconsultant
https://marquistopengineers.com/tag/chief-operating-officer/
Chief Operating Officer Archives - Top Engineers
chief operating officerarchivestopengineers
https://www.just-food.com/news/usa-sanderson-farms-appoints-chief-operating-officer/
USA: Sanderson Farms appoints chief operating officer - Just Food
Oct 22, 2004 - US poultry processor Sanderson Farms has announced that it has named Lampkin Butts as president and chief operating officer of the company.
chief operating officersanderson farmsusafood
https://erock.com/paul-froutan/
Paul Froutan | Chief Operating Officer at Enchanted Rock
Dec 4, 2025 - Paul Froutan, COO of Enchanted Rock, applies tech leadership from Google and Rackspace to enhance energy resiliency and operational excellence.
chief operating officerpaulenchantedrock
https://jobs.ctgoodjobs.hk/jobs/chief-operating-officer-jobs
Chief Operating Officer Jobs in Hong Kong - May 2026 | CTgoodjobs
Explore 153 Chief Operating Officer jobs in Hong Kong. Browse through all our new daily-updated Chief Operating Officer job listing now!
jobs in hong kongchief operating officermay
https://finquota.com/insider/agarwal-devesh/
Agarwal Devesh - Chief Operating Officer of BAND | Insider Trading
Stock Insider Trading: Agarwal Devesh - Chief Operating Officer of BAND, CSSO and Interim COO of BAND, See Remarks of BAND
chief operating officerbandinsidertrading
https://www.latimes.com/archives/la-xpm-1995-10-09-fi-55012-story.html
New Chief Operating Officer Comes Aboard at Merisel - Los Angeles Times
Oct 9, 1995 - Merisel Inc. has appointed Ronald A. Rittenmeyer president and chief operating officer.
chief operating officerlos angelesnewcomes
https://www.autorentalnews.com/news/bandago-appoints-new-chief-operating-officer
Bandago Appoints New Chief Operating Officer | Auto Rental News
Aug 18, 2023 - The San Francisco-based van rental company promotes their longest-tenured employee.
chief operating officerauto rentalnew
https://phccnews.com/first-supply-appoints-new-chief-operating-officer/
First Supply Appoints New Chief Operating Officer - Blue Water PHCC News
Jan 21, 2020 - First Supply is pleased to announce the appointment of Mike Meiresonne to the role of Chief Operating Officer of their Distribution Company. After joining...
chief operating officerblue waterfirstsupplynew
https://finquota.com/insider/estepan-ian-michael/
Estepan Ian Michael - Chief Operating Officer of SRPT | Insider Trading
Stock Insider Trading: Estepan Ian Michael - Chief Operating Officer of SRPT, Chief Financial Officer of SRPT
chief operating officerianmichaelinsidertrading
https://timespro.com/executive-education/iim-indore-chief-operating-officer-programme
Join IIM Indore Chief Operating Officer Programme in 2026
Looking to elevate your career with a chief operating officer course? Join the IIM Indore COO programme by Timespro to enhance your leadership skills today!
chief operating officeriim indorejoinprogramme
https://featured.com/p/vincent-chan
Vincent Chan, Chief Operating Officer - Christina | Featured
Vincent Chan is a Chief Operating Officer. Discover Vincent Chan's insights and get in touch for knowledge and expertise
chief operating officervincent chanchristinafeatured
https://revpath.dealhub.io/jobs/229382681-chief-operating-officer-chief-financial-officer
Chief Operating Officer / Chief Financial Officer at Doran Leadership Partners - RevPath
chief operating officerfinancialleadershippartnersrevpath
https://www.securitysales.com/insights/john-szczygiel-brivo-best-security-advice/618477/
John Szczygiel, Chief Operating Officer, Brivo: Best Advice - Security Sales & Integration
Apr 28, 2026 - Szczygiel offers up the best advice he's ever gotten, gives tips to security industry newcomers and names an industry-wide inspiration.
chief operating officerjohn
https://jobs.ctgoodjobs.hk/job/10092750/operations-director-chief-operating-officer-coo-retail-consumer-banking-se-asia-based
Operations Director / Chief Operating Officer (COO) - Retail & Consumer Banking (SE Asia based) -...
chief operating officeroperations director
https://www.michaelpage.com.cn/en/job-detail/chief-operating-officer-coo-advanced-manufacturing/ref/jn-092023-6197440?aplitrak_email=bWFyY29tYS4yNjAwNi41NDAzQHBhZ2Vjbi5hcGxpdHJhay5jb20&lang=en
Chief Operating Officer (COO) - Advanced Manufacturing - JN-092023-6197440 | Michael Page
As the COO of Advanced Manufacturing, you will play a pivotal role in shaping the future of our company. You will be responsible for overseeing all aspects of...
chief operating officeradvanced manufacturingcoo
https://cooperatie.nl/nieuws/philippe-vollot-beoogd-chief-operating-officer-bij-rabobank/
Philippe Vollot beoogd Chief Operating Officer bij Rabobank - NCR
Oct 7, 2025 - Rabobank richt een nieuwe functie in binnen de groepsdirectie: Chief Operating Officer (COO). Philippe Vollot, momenteel Chief Financial Economic Crime Officer...
chief operating officerphilippebijrabobankncr
https://www.hpe.com/dk/en/about/jobs/ocoo-early-career-program.html
Office of Chief Operating Officer OCOO Early Career Program | HPE Denmark
he Office of the Chief Operating Officer (OCOO) early career program is designed to provide students with work experience around driving operational...
chief operating officerearly career
https://www.businesswire.com/news/home/20230907606608/en/Rapport-Therapeutics-Appoints-Chief-Operating-Officer-and-Scientific-Advisory-Board-Member?_gl=1*1vjompc*_ga*MTk4NzQxMTI5My4xNjkxMTUzMDYx*_ga_ZQWF70T3FK*MTY5NDA4NzczNy4yNy4xLjE2OTQwODgwNzMuMi4wLjA
Rapport Therapeutics Appoints Chief Operating Officer and Scientific Advisory Board Member
Rapport Therapeutics today announced the appointment of Cheryl Gault as COO and Wendy Young, Ph.D., as a member of its Scientific Advisory Board.
chief operating officerscientific advisory boardrapporttherapeutics
https://channellife.com.au/tag/chief-operating-officer?page=1
Chief Operating Officer Stories - ChannelLife Australia
A list of all Chief Operating Officer (COO) stories - ChannelLife Australia.
chief operating officerstoriesaustralia
https://www.ensafrica.com/people/detail/1010/
ENS - People - Otsile Matlou - Chief Operating Officer - broad-based black economic empowerment...
Otsile Matlou is ENS' Chief Operating Officer. As COO, he ensures the seamless delivery of effective solutions for clients across the continent. Otsile is also...
chief operating officer
https://lardermag.co.uk/ooni-appoints-new-chief-operating-officer/
Ooni appoints new Chief Operating Officer - Larder Magazine
Jul 16, 2025 - Ooni, the creator and leader of the home pizza oven market, has appointed Amanda Tolhurst as its new Chief Operating Officer.
chief operating officerooninewlardermagazine
https://www.truelancer.com/freelancer/jacqueswhite
Jacques White - Chief operating officer - Freelancer from Cape Town, South Africa
Contact Jacques White to Hire Chief operating officer, Freelancer from Cape Town, South Africa. Find Professioanl Freelancers and Experts for your Project with...
chief operating officercape townjacqueswhite
https://www.xing.com/profile/Shanta_Rahman
Shanta Rahman - Vice President, Chief Operating Officer (COO) - Clipping Pix | XING
Shanta Rahman, Dhaka Professional experience, contact details, portfolio, etc.: Find out more or get in touch with Shanta Rahman on XING.
chief operating officervice presidentrahman
https://www.webwire.com/ViewPressRel.asp?aId=208193
Anthony Craun Named Chief Operating Officer of Sand Hill Global Advisors | WebWire
Sand Hill Global Advisors, a provider of wealth management services in Silicon Valley, announced today that Director of Operations Anthony Craun, CFA, has been...
chief operating officer
https://www.vcuhealth.org/news/virginia-premier-names-kurt-small-as-chief-operating-officer/
Virginia Premier names Kurt Small as chief operating officer | VCU Health
chief operating officervirginiapremiernameskurt
https://comidoc.com/udemy/coo-essentials-master-operational-excellence-and-leadership
COO Course: Chief Operating Officer & Ops Director [EN] | Comidoc
May 6, 2026 - Certified COO | Operations Management | Business Operations | Process Improvement | Ops Strategy | Ops Director
chief operating officercoocourseopsdirector
https://www.salamancapress.com/2025/04/08/newmark-promotes-luis-alvarado-to-chief-operating-officer/
Newmark Promotes Luis Alvarado to Chief Operating Officer - Salamanca Free Press
Apr 10, 2025 - Role Includes Operational Oversight of Fastest-Growing Publicly Traded CRE Company1
chief operating officernewmarkluisalvarado
https://admh.in/project/baljit-singh-bedi-chief-operating-officer-of-telemedicine-society-of-india/
Baljit Singh Bedi Chief Operating Officer of Telemedicine Society of India - ADMH
Baljit Singh Bedi is Chief Operating Officer of Telemedicine Society of India. He completed his BTech and MTech from the Indian Institute of Technology (IIT),...
chief operating officersingh
https://manual.compoundplanning.com/chapters/interview-with-akshay-kothari-chief-operating-officer-at-notion
Interview with Akshay Kothari, Chief Operating Officer at Notion - Compound Manual
This interview is with Akshay Kothari. Akshay joined Notion in 2018 and is currently their Chief Operating Officer. During his time at Notion, Akshay has...
chief operating officerinterview withakshay
https://nairametrics.com/2025/01/15/custodian-investment-plc-appoints-adeniyi-falade-as-chief-operating-officer/
Custodian Investment Plc appoints Adeniyi Falade as Chief Operating Officer - Nairametrics
Jan 15, 2025 - Custodian Investment Plc has announced the appointment of Mr. Adeniyi Falade as its Chief Operating Officer. This was disclosed in
chief operating officercustodianinvestmentplc
https://featured.com/p/onkar-avinash
Onkar Avinash, Chief Operating Officer-COO - Envision Next | Featured
Onkar Avinash is a Chief Operating Officer-COO specializing in Autocad, Construction Management, Engineering, Microsoft Excel, and Microsoft Office. Discover...
chief operating officeravinashcooenvisionnext
https://www.siliconvalleypower.com/Home/Components/News/News/45585/6271?backlist=%2Fsvp-and-community%2Fabout-svp%2Fpower-content-label
Silicon Valley Power Appoints New Chief Operating Officer | SVP News List | Silicon Valley Power
chief operating officersilicon valleypowernew
https://www.saxbam.com/insights/appointments/st-john-ambulance-appoints-chief-operating-officer/
St John Ambulance appoints Chief Operating Officer - Saxton Bampfylde
Mar 12, 2026 - St John Ambulance has appointed the former director of operations at the Welsh Ambulance Service (WAST) as Chief Operating Officer in a new role created to...
st john ambulancechief operating officer
https://topofminds.com/vacature-coo-cleanlease/
Vacature: Chief Operating Officer (COO) bij CleanLease | Top of Minds
Dec 4, 2025 - Vanuit 26 locaties speelt het bedrijf een belangrijke rol in de Nederlandse en Belgische maatschappij. In een dynamische en complexe sector zorgt de hands-on...
chief operating officervacaturecoobijtop
https://www.techmezine.com/top-10-news/new-chief-operating-officer-rohde-schwarz/
New Chief Operating Officer at Rohde & Schwarz -
chief operating officernewrohdeschwarz
https://iamceo.co/tag/chief-operating-officer/
chief operating officer | I AM CEO Podcast
chief operating officerceopodcast
https://greenpost.com.pk/tag/chief-operating-officer-abid-hussain/
Chief Operating Officer Abid Hussain Archives -
chief operating officerabidhussainarchives
https://magazinebbm.com/blog/schubert-appoints-dominik-streicher-as-chief-operating-officer-2649
Schubert appoints Dominik Streicher as Chief Operating Officer | BBM Magazine
Schubert North America has appointed Dominik Streicher as Chief Operating Officer for its Canadian entity Schubert Packaging Automation Inc. in Mississauga,...
chief operating officerschubertdominikstreicherbbm
https://careers.msedetroit.org/jobs/category/executive-executive-director
Chief Operating Officer - Kalamazoo Event Center in Kalamazoo, MI for Greenleaf Hospitality Group
Exciting opportunity in Kalamazoo, MI for Greenleaf Hospitality Group as a Chief Operating Officer - Kalamazoo Event Center
chief operating officerevent center
https://www.resonancesearch.com/roles/chief-operating-officer-coo-vs-chief-strategy-officer-vs-consultant
Chief Operating Officer (COO) vs Chief Strategy Officer vs Consultant
Compare Chief Operating Officer (COO), Chief Strategy Officer, and Consultant across responsibilities, authority, and collaboration.
chief operating officercoovsstrategyconsultant
https://milehighcre.com/northstar-commercial-partners-announces-new-chief-operating-officer/
Northstar Commercial Partners Announces New Chief Operating Officer - Mile High CRE
Aug 3, 2016 - Northstar Commercial Partners Announces New Chief Operating Officer -
chief operating officercommercial partnersmile highnorthstarannounces
https://metepolibabs.education/dt_testimonials/nicola-sanitatechief-operating-officer-apuliasoft/
NICOLA SANITATEChief Operating Officer - APULIASOFT - Mete Spegea Business School
Nov 10, 2022 - "In veste di proprietario di azienda con background tecnico, il Master in Business Administration di Spegea mi ha permesso di acquisire tutte le competenze...
operating officernicolametebusinessschool
https://careers.umich.edu/job_detail/275881/associate-chief-operating-officer-ambulatory-cardiovascular-services-and
Associate Chief Operating Officer, Ambulatory Cardiovascular Services and Ambulatory Surgical...
chief operating officercardiovascular servicesassociateambulatorysurgical
https://www.erevena.com/recent-searches/erevena-place-chief-operating-officer-for-motork/
Erevena place Chief Operating Officer for MotorK - Erevena
chief operating officerplacemotork
https://internationalbusinesswatch.com/article/836180687-damon-feltman-appointed-chief-operating-officer-of-the-space-force-association
Damon Feltman Appointed Chief Operating Officer of the Space Force Association | International...
chief operating officer
https://www.plannedcompanies.com/astrit-gorana-promoted-chief-operating-officer/
Astrit Gorana Promoted to Chief Operating Officer - Planned Companies
Oct 6, 2017 - Planned Companies is excited to announce that Astrit (Tony) Gorana, Executive Vice President of Planned Building Services, will be promoted to Chief Operating...
chief operating officerastritpromotedplannedcompanies
https://www.drcog.org/news/jenny-hunnings-named-chief-operating-officer-denver-regional-council-governments
Jenny Hunnings named chief operating officer for Denver Regional Council of Governments | Denver...
chief operating officer
https://images.apple.com/kw/newsroom/2025/07/apple-announces-chief-operating-officer-transition/
Apple announces chief operating officer transition - Apple (KW)
Apple today announced Jeff Williams will transition his role as chief operating officer later this month to Sabih Khan.
chief operating officerappleannouncestransitionkw
https://coo.uq.edu.au/operational-areas/information-technology/careers-its/learning-and-development
Learning and development - Chief Operating Officer Portfolio - University of Queensland
learning and developmentchief operating officerportfoliouniversityqueensland
https://hooperlawoffice.com/adam-cain
Adam Cain, Chief Operating Officer | Hooper Law Office
Adam Cain is the Chief Operating Officer at Hooper Law Office, LLC
chief operating officeradamcainhooperlaw
https://vitacohealth.com/role/chief-operating-officer/
Chief Operating Officer Archives | Vitaco Health
chief operating officerarchiveshealth
https://fr.slideserve.com/rowena/steve-pearce-chief-operating-officer-powerpoint-ppt-presentation
PPT - Steve Pearce Chief Operating Officer PowerPoint Presentation, free download - ID:5287506
Steve Pearce Chief Operating Officer. Managed Services Industry Hype or a real solution to key business continuity issues ? (Developing trend or latest fad ?)....
chief operating officer
https://www.theprivateoffice.com/about-us/leadership-team/nigel-yeo
Nigel Yeo - Chief Operating Officer | The Private Office
Nigel Yeo is The Private Office's Director of Advice and a Chartered Financial Planner. He deals with all matters private client with particular experience...
chief operating officerthe privatenigelyeo
https://worldmedicinefoundation.com/health-news/bit-bio-appoints-kathryn-corzo-as-chief-operating-officer/
bit.bio appoints Kathryn Corzo as Chief Operating Officer - worldmedicinefoundation
Nov 19, 2021 - Cell coding company bit.bio today announces the key appointment of Kathryn Corzo as Chief Operating Officer. She started in the
chief operating officerbitbiokathryncorzo
https://www.marshmma.com/us/insights/details/marsh-mclennan-agency-announces-amanda-vail-as-chief-operating-officer-for-southeast-region.html
Amanda Vail is new Chief Operating Officer, Southeast | MMA
chief operating officeris newamandavailsoutheast
https://www.autoremarketing.com/ar/wholesale/naaa-names-chief-operating-officer/
NAAA names chief operating officer | Auto Remarketing
Sep 23, 2024 - The National Auto Auction Association said Friday it has promoted Tricia Heon to the new position of chief operating officer. She has served as legislative dire
chief operating officernamesautoremarketing
https://telecomdrive.com/tag/chief-operating-officer/
Chief Operating Officer | TelecomDrive
chief operating officer
https://www.deloitte.com/ua/en/about/people/profiles.mrybchynskyi-en%2Ba4d5a86f.html
Mykola Rybchynskyi | Chief Operating Officer of Deloitte Academy
chief operating officerdeloitteacademy
https://www.dcibin.com/coo
Chief Operating Officer (COO) | DCI Bible Institute
The office of the chief operating officer oversees all aspects of administration, operations and staff members.
chief operating officercoodcibibleinstitute
https://charleebear.com/team/patrick-mcgarry/
Meet Patrick McGarry, Chief Operating Officer At Charlee Bear
Patrick is our leader who manages Charlee Bear, from strategy and operations to product development, sales and marketing.
chief operating officermeetpatrickmcgarrycharlee
https://bluestonestrategy.com/chief-operating-officer/
Chief Operating Officer - Blue Stone Strategy Partners
chief operating officerblue stonestrategypartners
https://summittalentgroup.com/chief-operating-officer/chief-operating-officer-search/
Chief Operating Officer Search - Summit Talent Group
Aug 25, 2018 - Chief Operating Officer Search Bon Secours Health System
chief operating officersearchsummittalentgroup
https://nashville.newsnetmedia.com/story/213527/fox-corporation-president-and-chief-operating-officer-john-nallen-to-participate-in-moffettnathansons-media-internet-communications-conference-2026/
Fox Corporation President and Chief Operating Officer John Nallen to Participate in...
chief operating officerfox corporation
https://www.slaytonsearch.com/tag/chief-operating-officer/
chief operating officer Archives - Slayton Search
chief operating officerarchivesslaytonsearch
https://www.biospace.com/alligator-bioscience-ab-appoints-chief-operating-officer
Alligator Bioscience AB Appoints Chief Operating Officer - BioSpace
Dec 2, 2019 - Alligator Bioscience announced that the company has appointed Dr Malin Carlsson as Chief Operating Officer.
chief operating officeralligator bioscienceabbiospace
https://www.girlslearningtrust.org/latest-news/chief-operating-officer-blog
Girls' Learning Trust - Chief Operating Officer Blog
chief operating officergirlslearningtrustblog
https://www.walshbrothers.com/team_designation/vice-president-and-chief-operating-officer/
Vice President and Chief Operating Officer Archives
chief operating officervice presidentarchives
https://www.apple.com/uk/newsroom/2025/07/apple-announces-chief-operating-officer-transition/
Apple announces chief operating officer transition - Apple (UK)
Apple today announced Jeff Williams will transition his role as chief operating officer later this month to Sabih Khan.
chief operating officerappleannouncestransitionuk
https://www.veehealthtek.com/about-us/leadership-team/muralidhar-padmanabharao.htm
Muralidhar P, Chief Operating Officer of Vee Healthtek
Get to know Muralidhar Padmanabharao, COO of Vee Healthtek, manifesting strategy, service delivery, and innovative technologies for business transformation.
chief operating officervee
https://healthjobsng.com/chief-operating-officer-at-the-guardian/
Chief Operating Officer At The Guardian - Health Jobs NG
Jan 17, 2022 - Job description KINGS COMMERCIAL SERVICES Are you looking for a new, exciting and challenging opportunity to expand your portfolio of expertise? We would like...
chief operating officerthe guardianhealth jobs
https://www.bluefernhomes.com/latest-news/employee-spotlight-michelle-branley-chief-operating-officer
Employee Spotlight: Michelle Branley, Chief Operating Officer | Blue Fern Homes
Employee Spotlight: Michelle Branley, Chief Operating Officer | Blue Fern Homes
chief operating officeremployee spotlightmichellebluefern
https://www.hiroic.ai/job-description/chief-operating-officer
Generate a Chief Operating Officer Job Description | Hiroic
Hiroic's AI hiring expert creates a fully custom chief operating officer job description and hiring plan based on your company's needs. No more misaligned...
chief operating officerjob descriptiongenerate
https://idcm.eu/job_category/chief-financial-and-operating-officer/
Chief Financial and Operating Officer Archives - IDCM | Finance Advice & ServicesIDCM | Finance...
operating officerfinance advicechieffinancialarchives
https://coo.uq.edu.au/operational-areas/finance/finance-staff/accounting
Accounting - Chief Operating Officer Portfolio - University of Queensland
chief operating officeraccountingportfoliouniversityqueensland
https://councils.forbes.com/profile/John-Whittle-Chief-Operating-Officer-Fortinet/566cdafb-136c-4a43-87ad-93e3f25801c5
John Whittle | Chief Operating Officer - Fortinet | Forbes Business Council
chief operating officerforbes businessjohnfortinetcouncil
https://theorg.com/org/harris-group-inc/org-chart/todd-alsdorf
Todd Alsdorf - Chief Operating Officer at Harris Group Inc. | The Org
Todd Alsdorf has an extensive work experience spanning several industries.
chief operating officertoddalsdorf
https://www.tnhglobal.com/aalia-collection-appoints-kavinder-besoya-as-chief-operating-officer-for-india/
Aalia Collection appoints Kavinder Besoya as Chief Operating Officer for IndiaAalia Collection...
Apr 9, 2024 - Aalia Collection, the latest boutique hospitality venture by JPL Hospitality Services Pvt. Ltd. is pleased to announce the appointment of Kavinder Besoya as...
chief operating officeraaliacollection
https://kapitus-plus.com/press-coverage/what-does-the-post-covid-concrete-renovation-market-look-like/attachment/final_headshot_benjohnston/
Ben Johnston, Chief Operating Officer - Kapitus
chief operating officerbenjohnstonkapitus
https://coo.uq.edu.au/operational-areas/information-technology/careers-its/why-i-work-its-luke-angel
Operational areas - Chief Operating Officer Portfolio - University of Queensland
chief operating officeroperational areasportfoliouniversityqueensland
https://rendevordialysis.com/tag/chief-operating-officer/
Chief Operating Officer Archives - Rendevor Dialysis
chief operating officerarchivesdialysis
https://www.internetnews.me/tag/chief-operating-officer/
Chief operating officer Archives - Domain Industry & Internet News
chief operating officerarchivesdomainindustryinternet
https://ggapartners.com/2024/11/executive-search-general-manager-derrick-golf-and-winter-club/
Executive Search: General Manager/Chief Operating Officer, Derrick Golf & Winter Club
chief operating officerexecutive searchgeneral manager