https://imperialpaper.com/blog/tag/packaging-sustainability-strategy/
#Packaging sustainability strategy Archives - Imperial Paper Co.
packaging sustainabilitystrategyarchivesimperialpaper
https://delibusiness.com/packaging-sustainability-in-the-deli/
Packaging Sustainability in the Deli - Deli Business
May 3, 2025 - Discover the many benefits of operating with an eye on the environment. Sustainability has become a big issue in recent years for consumers, as well as super
packaging sustainabilitythe delibusiness
https://www.valupapers.com/packaging-sustainability/
ODM Packaging Sustainability Solutions | Valupap Manufacturer & Exporter
Ningbo Valupaper Co., Limited offers sustainable packaging solutions tailored to your needs. As dedicated exporters and manufacturers, we prioritize packaging...
odm packagingsustainability solutionsmanufacturerexporter
https://www.en.nvc.nl/news/item/nl-eerste-set-brancheverduurzamingsplannen-gereed/
NL: Packaging sustainability plans for 3 industry groups - NVC Packaging Centre
The Netherlands Knowledge Institute Sustainable Packaging (KIDV) has sent the first set of sustainability plans for the industry to the Ministry of...
packaging sustainabilityindustry groupsnlplansnvc
https://apparelresources.com/business-news/sustainability/systemiq-proposes-sustainable-study-packaging/
Systemiq proposes a sustainable study for packaging | Sustainability News UK
Jul 11, 2023 - Systemiq publishes a study for achieving a high-circularity, low-emissions system for PET packaging.
for packagingsustainability newssystemiqproposessustainable
https://www.packagingdive.com/news/mckinsey-sustainability-report-consumer-sentiment/691048/
Packaging sustainability looks different to consumers post-pandemic | Packaging Dive
Hygiene still is important to global consumers, but they differ on views of which packaging substrates are most sustainable, according to a new McKinsey report.
packaging sustainabilitylooksdifferentconsumerspost
https://cadbury.com.au/packaging-sustainability/index.html
Packaging Sustainability | Cadbury.com.au
Discover how to dispose of your packaging thoughtfully so we can all do our bit for the planet.
packaging sustainabilitycadburyau
https://www.toptenbusinessexperts.com/tag/packaging-sustainability/
packaging sustainability Archives - Top Ten Business Experts
packaging sustainabilitytop tenarchivesbusinessexperts
https://www.foodingredientsfirst.com/news/the-first-global-measurement-system-for-packaging-sustainability-is-released.html
The First Global Measurement System for Packaging Sustainability is Released
the firstfor packagingglobalmeasurementsystem
https://discoverboost.com/consultants/1490/
Global Packaging & Sustainability Executive | Materials, Printing & Food Safety Expert | Driving...
packaging sustainabilityfood safetyglobalexecutivematerials
https://emeralddirectory.com/listings852774/dedicated-peptide-packaging-sustainability-programs-buy-retatrutide-online-with-enterprise-level-procurement-support
Dedicated Peptide packaging sustainability programs Buy Retatrutide online with enterprise level...
buy retatrutide onlinepackaging sustainabilitydedicatedpeptideprograms
https://www.clinique.com.tr/sustainability/responsible-packaging
Beauty | Packaging Sustainability | Clinique
We assess the impact of our products across their entire life cycle. We are dedicated to making our packaging more sustainable.
packaging sustainabilitybeautyclinique
https://www.terra.do/climate-jobs/job-board/Packaging-Sustainability-Analyst-Sterling-Engineering-8389176/
Packaging Sustainability Analyst at Sterling Engineering
Learn more about the Packaging Sustainability Analyst position at Sterling Engineering.
packaging sustainabilityanalyststerlingengineering
https://dapak.co.uk/sustainability-audit/
Packaging Sustainability Audit | No Obligations - DaPak
packaging sustainabilityauditobligations
https://www.smitherspira.com/en-gb/industries/packaging/manufacturers-and-users/sustainable-packaging/packaging-sustainability-gap-analysis
Packaging Sustainability Gap Analysis | Packaging | Smithers
Our experts will help with meeting legislation and industry initiatives by analyzing your materials and processes as part of a sustainable gap analysis.
sustainability gap analysispackagingsmithers
https://delterra.org/knowledgehub/could-you-help-shape-our-new-packaging-sustainability-platform/
Could You Help Shape our New Packaging Sustainability Platform? - Delterra
new packagingsustainability platformcouldhelpshape
https://packagingsuppliersglobal.com/news/sustainability/p2
Packaging Sustainability | Packaging Suppliers Global
The latest packaging Sustainability news covering everything from food, pharma and industrial pacakging to materials, machines and equipment.
packaging sustainabilitysuppliersglobal
https://thaibeveragecan.com/tbc-joins-packaging-sustainability-symposium-embracing-the-circular-economy-event/
TBC Joins "Packaging Sustainability Symposium: Embracing the Circular Economy " Event - Thai...
Aug 14, 2024 - TBC participated in the "Packaging Sustainability Symposium: Embracing the Circular Economy" On 23 January 2024, Thai Beverage Industry Association
the circular economypackaging sustainabilitytbcjoinssymposium
https://xnkminhanh.com/packaging-sustainability-driving-a-sustainable-future.html
Packaging Sustainability: Driving a Sustainable Future
Mar 6, 2024 - This article will take you deeper into understanding packaging sustainability, explain why it's important to the environment and the community,....
packaging sustainabilitydrivingsustainablefuture
https://repository.rit.edu/theses/364/
"An Overview of packaging sustainability topics" by Alexandros Astropekakis
This thesis presents the global challenges behind the need of sustainable development. It links packaging to this need and describes the way packaging can...
an overviewpackaging sustainabilitytopicsalexandros
https://shipmaster.com/embracing-the-future-top-packaging-sustainability-trends-in-2024/
Embracing the Future: Top Packaging Sustainability Trends in 2024 - Shipmaster Containers Ltd
Dec 3, 2024 - The discussion on sustainability worldwide has grown significantly. In these changing times, packaging plays a leading role. Organizations prioritize modern...
the futurepackaging sustainability
https://adintus.com/en/blog/nuevo-packaging-de-adintus-sostenibilidad/
New Adintus packaging: sustainability, innovation and modernity
Jul 23, 2025 - Discover the new Adintus packaging, designed with innovation and sustainability to offer modern and ecological solutions to our industrial customers.
packaging sustainabilitynewinnovationmodernity
https://www.packagingnew.com/
Packaging News, Design, Sustainability & Machinery Insights | PackagingNew
PackagingNew covers packaging industry news, sustainable packaging trends, package design, materials science, machinery, supply chain developments, and smart...
packaging newsdesignsustainabilitymachineryinsights
https://www.licpackaging.com/en/christmas-2023-sustainability-circular-economy/
Christmas 2023: Sustainability & Circular Economy | LIC Packaging Spa
circular economychristmassustainabilitylicpackaging
https://ipl.co.tz/setting-up-sustainability-goals-for-your-brand/
Setting Up Sustainability Goals For Your Brand - Industrial Packaging Limited
Sep 4, 2025 - Achieving meaningful change requires more than good intentions; it starts with clear, structured, and realistic sustainability goals.
setting upsustainability goalsfor yourindustrial packagingbrand
https://www.berlinpackaging.com/insights/sustainability-legislation
Sustainability Legislation Insights | Berlin Packaging
As more states continue to propose and pass packaging legislation, sustainable packaging solutions are critical. Read more about Sustainable Legislation.
sustainability legislationinsightsberlinpackaging
https://www.3rsustainability.com/3r-sustainability-sustainable-packaging-coalition/
3R Sustainability Joins the Sustainable Packaging Coalition - 3R Sustainability
Jan 16, 2026 - 3R Sustainability joined the Sustainable Packaging Coalition (SPC), an industry-leading collaborative dedicated to advancing sustainable packaging systems and...
sustainable packagingsustainabilityjoinscoalition
https://spnews.com/
Sustainable Packaging News | Taking the lead in sustainability - Sustainable Packaging News
Sustainable Packaging News provide audience with indispensable, up-to-date information on all aspects of sustainable packaging, incorporating; circular...
sustainable packagingthe leadnewstakingsustainability
https://www.nivea.co.uk/about-us/sustainability-at-nivea/sustainable-packaging-design?cmpscreenscustom
Sustainable Packaging Design | NIVEA Sustainability
Learn about how our achievements and targets to create sustainable product packaging help us to prevent pollution and decrease our CO2 emissions.
sustainable packagingdesignniveasustainability
https://www.aegg.co.uk/blog/sustainability-aegg-achieves-sbti-validation
Sustainability: Aegg Achieves SBTi Validation | Aegg Creative Packaging
sbti validationsustainabilitycreativepackaging
https://www.formesdeluxe.com/sustainability/
Sustainability - Luxe Packaging Insight
Discover the latest sustainable packaging solutions for the luxury market. Subscribe to our newsletter and track the most pertinent luxury packaging trends.
sustainabilityluxepackaginginsight
https://imperialpaper.com/blog/tag/packaging-sustainability-strategy/
#Packaging sustainability strategy Archives - Imperial Paper Co.
packaging sustainabilitystrategyarchivesimperialpaper
https://biscamagazine.co.uk/uvlack/
UVLack in Printing and Packaging: Speed, Quality and Sustainability
Dec 22, 2025 - UVLack, also known as UV lacquer, is a specialized coating technology that cures instantly when exposed to ultraviolet light. Unlike traditional solvent-based
printing and packagingspeedqualitysustainability
https://upsstoreus.com/2025/06/22/sustainability-officer-perspective-how-upsstore-revolutionizes-packaging-and-printing-2/
Sustainability Officer perspective: How upsstore revolutionizes packaging and printing - UPSStore...
Jun 22, 2025 - Explore how upsstore leverages sustainable practices and innovative solutions to transform the packaging and printing industry, offering both B2B and B2C...
sustainability officerperspectiverevolutionizespackagingprinting
https://sustainability.packagingnews.co.uk/sustainabilityandimpact2026/en/node/organisation-fpa-1
Packaging News Sustainability & Impact Summit & Awards 2026 | Sustainable Packaging Event
packaging newssustainability impactsummit awardssustainableevent
https://delibusiness.com/packaging-sustainability-in-the-deli/
Packaging Sustainability in the Deli - Deli Business
May 3, 2025 - Discover the many benefits of operating with an eye on the environment. Sustainability has become a big issue in recent years for consumers, as well as super
packaging sustainabilitythe delibusiness
https://www.rockwellautomation.com/en-ie/company/news/blogs/balancing-sustainability-and-efficiency-in-packaging-processes.html
Balancing Sustainability and Efficiency in Packaging Processes | Rockwell Automation | IE
Sustainability needs to be achieved without affecting efficiency. However, when companies get this balancing act right, the benefits are huge.
packaging processesrockwell automationbalancingsustainabilityefficiency
https://spnews.com/trivium-platinum/
Trivium Packaging Retains Platinum Sustainability Rating by EcoVadis For Commitment to Sustainable...
trivium packagingsustainability rating
https://www.allpack.uk.com/blog/ai-artificial-intelligence-sustainability-packaging-industry
Can AI Be Used To Accelerate Sustainability in the Packaging Industry?
In today's data-driven, interconnected environment, technology has enabled innovation across virtually all sectors. Among the wave of new solutions reaching...
used tothe packagingai
https://www.valupapers.com/packaging-sustainability/
ODM Packaging Sustainability Solutions | Valupap Manufacturer & Exporter
Ningbo Valupaper Co., Limited offers sustainable packaging solutions tailored to your needs. As dedicated exporters and manufacturers, we prioritize packaging...
odm packagingsustainability solutionsmanufacturerexporter
https://www.brighterdaysbhs.com/group/mysite-200-group/discussion/11ff93f3-668d-41d1-bef0-4552f8f8339c
Sustainability has become a central concern in packaging, dr | Group | Brighter Days Behavi
Aug 11, 2025 - Sustainability has become a central concern in packaging, driven by increasing environmental awareness and regulatory pressure. Biodegradable packaging offers...
https://zxalu.com/news/view/aluminum_foil_the_ultimate_yogurt_packaging.html
Why Aluminum Foil is the Ultimate Yogurt Packaging Material for Freshness and Sustainability
When it comes to yogurt packaging material, the choice of material plays a pivotal role in preserving quality, extending shelf life, and enhancing brand appeal.
https://www.packshion.com/a-how-packaging-box-manufacturers-help-reduce-waste-and-enhance-sustainability.html
How Packaging Box Manufacturers Help Reduce Waste and Enhance Sustainability | Packshion
Whether you are a brand manager looking to shrink your environmental footprint, a curious consumer wondering how everyday boxes end up recycled, or a...
packaging boxreduce wastemanufacturershelp
https://www.en.nvc.nl/news/item/nl-eerste-set-brancheverduurzamingsplannen-gereed/
NL: Packaging sustainability plans for 3 industry groups - NVC Packaging Centre
The Netherlands Knowledge Institute Sustainable Packaging (KIDV) has sent the first set of sustainability plans for the industry to the Ministry of...
packaging sustainabilityindustry groupsnlplansnvc
https://library.rolltoroll.org/blog/sustainability-and-life-cycle-technology-for-packaging/
Sustainability and Life Cycle Technology for Packaging
Mar 25, 2024 - Presented by M. Luhrs, E. Griffing, M. Realff, and M. Overcash, Environmental Clarity, LLC, Georgia Institute of Technology overcash1_absovercash1_abs.pdf9...
life cyclesustainabilitytechnologypackaging
https://merchants.doordash.com/en-ca/blog/food-delivery-containers
Eco-Friendly Food Packaging Options and Sustainability Tips for Restaurants
Learn about eco friendly takeout food containers and get tips to make your restaurant more sustainable, earth friendly, and cost-effective.
eco friendlyfood packagingsustainability tipsoptionsrestaurants
https://www.greinersupply.com/blog/greiner-in-the-united-states-recyclable-pp-foam-packaging-innovation-and-north-113.html
Medical Packaging Innovation Trends 2025: Smart Technologies and Sustainability | Greiner Blog
Explore the five major trends shaping medical packaging in 2025: smart packaging sensors, bio-based materials, AI quality control, blockchain traceability, and...
medical packaginginnovation trendssmart technologies
https://parksonspackaging.com/about/quality-and-certifications/
Parksons Packaging | Exceeding Expectations with Quality Excellence and Sustainability
Jan 29, 2026 - Explore Parksons Packaging Ltd.'s unwavering commitment to quality and sustainability, backed by certifications such as BRC Global Standard, FSC, ISO 9001, ISO...
exceeding expectationsquality excellencepackagingsustainability
https://environmentalnewscroatia.com/article/863244771-eu-packaging-waste-outlook-2023-2034-trends-recycling-performance-and-sustainability-progress
EU Packaging Waste Outlook 2023-2034 Trends, Recycling Performance, and Sustainability Progress |...
Environmental News Croatia is an online news publication focusing on environment in the Croatia: Keeping up with environment news from Croatia
packaging waste
https://gentlever.com/is-digital-printing-sustainable/
Is Digital Printing Sustainable? Sustainability Guide for Packaging
Learn digital printing sustainability and how the process reduces setup waste, lowers VOCs, and supports eco-friendly custom packaging production.
digital printingsustainability guidesustainablepackaging
https://reliancepak.com/blog/blog_1115-10/
How Can Bagasse Packaging Material Contribute to Sustainability in the Electronics Industry? -...
Nov 18, 2024 - The electronics industry generates massive amounts of waste from packaging, which contributes significantly to environmental pollution. Traditional packaging...
bagasse packaging
https://www.specright.com/case-studies/rodan-fields-case-study/
Rodan + Fields: Managing Packaging & Driving Sustainability
Sep 8, 2025 - As a tech-driven company, R+F knew there had to be a better way to manage packaging specifications than in spreadsheets or shared drives.
rodanfieldsmanagingpackagingdriving
https://fibre-revolution.com/our-sustainability/
Our Sustainability - Fibre Packaging, a True Solution.
Dry Moulded Fibre Manufacturing is a cornerstone for the packaging industry. It offers sustainable packaging solution that is sourced, manufactured and
our sustainabilityfibrepackagingtruesolution
https://bestboxstore.com/ecommerce-packaging-challenges
E-commerce Packaging: Protection vs. Sustainability Balance
E-commerce packaging challenges by balancing product protection with waste reduction. Learn size optimization and sustainable solutions that reduce shipping...
e commercepackagingprotectionvssustainability
https://petsustainability.org/events/designing-for-circularity-applying-the-waste-hierarchy-in-pet-packaging/
Designing for Circularity: Applying the Waste Hierarchy in Pet Packaging - Pet Sustainability...
designing for circularitywaste hierarchypet packagingapplying
https://www.perduefarms.com/en-US/we-care.html
Perdue Farms Sustainability Efforts & Eco-Friendly Packaging | Perdue Farms
Learn how Perdue Farms protects the environment by choosing earth-friendly packaging and including a recyclable shopping tote and pollinator seed back in each...
perdue farmssustainability effortseco friendlypackaging
https://www.smitherspira.com/en-gb/resources/2021/april/sustainability-priority-in-rigid-plastic-packaging
Sustainability a priority among new developments in rigid plastic packaging
Mounting public pressure on brand owners and retailers to reduce the environmental impact of packaging is one of the biggest challenges facing rigid plastic...
new developmentsrigid plasticsustainabilitypriorityamong
https://www.upphandlingsmyndigheten.se/en/criteria/food/packaging-food-sector/packaging-food-sector/solutions-for-circular-packaging-within-the-food-sector/core/
Sustainability criterion for Solutions for circular packaging within the food sector | The National...
More circular packaging flows shall allow for recycling and ensure that food and production waste or damage in transit do not occur.
for solutionscircular packagingthe foodsustainabilitycriterion
https://ecoheven.com/2026-sustainability-outlook/
2026 Sustainability Outlook: Key Trends for Green Packaging
Sep 2, 2025 - 2026 sustainability outlook highlights key trends for green packaging innovations. Discover eco-friendly solutions shaping USA, UK, Canada
sustainability outlookkey trendsgreenpackaging
https://www.foodtechbiz.com/packaging/stora-enso-launches-beyond-board-to-advise-customers-on-packaging-sustainability
Stora Enso launches Beyond Board to advise customers on packaging sustainability
Stora Enso, a leading provider of renewable products in packaging, biomaterials, and wooden construction, has launched its Beyond Board
stora ensolaunchesbeyondboard
https://sustmeme.com/2020/09/18/sustainability-and-covid-19-future-of-packaging/
Sustainability & COVID-19: 'Future of Packaging' in The Times - SustMeme
Nov 26, 2020 - Sustainable packaging in a post-pandemic world: Article for report in 'The Times' weighs up the damage done to the market by COVID-19.
future ofthe timessustainabilitycovidpackaging
https://apparelresources.com/business-news/sustainability/systemiq-proposes-sustainable-study-packaging/
Systemiq proposes a sustainable study for packaging | Sustainability News UK
Jul 11, 2023 - Systemiq publishes a study for achieving a high-circularity, low-emissions system for PET packaging.
for packagingsustainability newssystemiqproposessustainable
https://wipak.com/latest/news/new-material-mix-with-50-paper-and-50-plastic/
Packaging News, Sustainability & Innovation Updates | Wipak
Jan 23, 2026 - Stay updated with Wipak news, innovations, and industry insights. Discover the latest developments in sustainable packaging, partnerships, and technology.
packaging newssustainabilityinnovationupdates
https://www.greinersupply.com/blog/greiner-bioone-amp-packaging-5-questions-i-wish-i039d-asked-before-my-93.html
Medical Packaging Innovation Trends 2025: Smart Technologies and Sustainability | Greiner Blog
Explore the five major trends shaping medical packaging in 2025: smart packaging sensors, bio-based materials, AI quality control, blockchain traceability, and...
medical packaginginnovation trendssmart technologies
https://ethy.co.uk/our-standards/clean-planet/recycled-packaging
Over 50% Recycled Packaging | Clean Planet Sustainability Standards | ethy
Over half of the brand's primary product packaging is made from recycled materials that have been recovered, reprocessed and converted into new materials.
recycled packagingclean planetsustainability standardsethy
https://www.amcor.com/sustainability/products
Sustainability Packaging | Recyclable Packaging Products | Amcor
recyclable productssustainabilitypackagingamcor
https://www.actega.com/cn/fr/press-events/news/interview-markus-locher.html
Shaping Tomorrow: Exploring Fibre-Based Packaging's Impact on Sustainability in the Packaging...
Read here our Interview with Markus Locher about Exploring Fibre-Based Packaging's Impact on Sustainability in the Packaging Industry
shaping tomorrow
https://www.packagingworldinsights.com/news/paper-packaging-market-evolves-to-meet-sustainability-goals/
Paper-Packaging Market Evolves To Meet Sustainability Goals
May 19, 2023 - Switching to paper-based packaging due to sustainability is driving the market changes alongside pandemic-related consumer behaviour and supply chain issues.
paper packagingmarketevolvesmeetsustainability
https://www.packagingdive.com/news/mckinsey-sustainability-report-consumer-sentiment/691048/
Packaging sustainability looks different to consumers post-pandemic | Packaging Dive
Hygiene still is important to global consumers, but they differ on views of which packaging substrates are most sustainable, according to a new McKinsey report.
packaging sustainabilitylooksdifferentconsumerspost
https://blog.paktech-opi.com/uk-insight-debunking-myths-in-the-uk-on-plastic-packaging-and-sustainability
UK INSIGHT: Debunking Myths in the UK on Plastic, Packaging and Sustainability
Debunking some of the most common myths surrounding plastic, packaging and environmental impact
debunking mythsplastic packagingukinsight
https://research.aston.ac.uk/en/publications/the-role-of-sustainability-in-scm-the-case-of-the-sustainable-pac/
The role of sustainability in SCM: the case of the sustainable packaging supply chain - Aston...
role of
https://www.globalsnus.com/eco-efficient-packaging-the-next-frontier-in-pouch-sustainability/
Eco-Efficient Packaging: The Next Frontier in Pouch Sustainability - Global Snus
Apr 19, 2026 - As the pouch industry matures in 2026, the definition of a premium product has evolved. It is no longer enough to offer high-quality nicotine or caffeine; the...
the next frontierecoefficientpackaging
https://www.apspackaging.co.uk/sustainability/
Sustainability - APS Packaging Ltd
Mar 9, 2026 - With responsibly sourced wood at the core of our business, APS Packaging is committed to sustainability and the best environmental practices in all aspect of
sustainabilityapspackagingltd
https://www.sustainabilityhq.com/why-brands-should-consider-these-tips-when-developing-sustainability-messaging-for-packaging/
Why Brands Should Consider These Tips When Developing Sustainability Messaging for Packaging - SHQ
https://petsustainability.org/psc_supplier/tyler-packaging-ltd/
Tyler Packaging Ltd - Pet Sustainability Coalition
tyler packaging ltdpetsustainabilitycoalition
https://xuntend.com/
Custom Food Packaging Solutions | Xuntend - Quality & Sustainability
Discover Xuntend's custom food packaging solutions. High-quality, eco-friendly options with flexible MOQs. Trusted by global brands like McDonald and Burger...
custom food packagingsolutionsqualitysustainability
https://cadbury.com.au/packaging-sustainability/index.html
Packaging Sustainability | Cadbury.com.au
Discover how to dispose of your packaging thoughtfully so we can all do our bit for the planet.
packaging sustainabilitycadburyau
https://sustainability.packagingnews.co.uk/sustainabilityandimpact2026/en/node/speakerprofile-smurfit-westrock-julie-elder
Packaging News Sustainability & Impact Summit & Awards 2026 | Sustainable Packaging Event
packaging newssustainability impactsummit awardssustainableevent