Robuta

Sponsor of the Day: Jerkmate
https://mbakerintl.com/patent-trademark-notice/ Patent & Trademark Notice - Michael Baker International Jan 14, 2026 - Name Patent No. System, Method and Computer Program Product For Siting A Land Parcel 11,704,758 System, Method, and Computer Products forOne-Dimensional... michael baker internationalpatent trademarknotice https://www.juve-patent.com/firm-profile/nlo-european-patent-trademark-attorneys/ NLO | European Patent & Trademark Attorneys - JUVE Patent european patenttrademark attorneysnlojuve https://natlawreview.com/practice-groups/IP-Patent-Trademark-Copyright Intellectual Property, Patent, Trademark, and Copyright Law | Nat Latest intellectual property legal news: patent law, copyright law, trademarks, trade secrets, IP Litigation, cloud computing, artificial intelligence, drug... intellectual property patentcopyright lawtrademarknat https://www.prv.se/en/trademarks/when-you-have-a-registered-trademark/fraudulent-invoices-and-scams/ Fake invoices relating to patent, trademark, design and domain names. - PRV PRV has observed an increasing amount of fake invoices or scam offers requesting payment relating to patent, trade mark, design and domain names. fake invoicespatent trademarkdomain namesrelatingdesign https://tsdr.uspto.gov/faqview United States Patent & Trademark Office united states patenttrademark office https://automatio.ai/how-to-scrape/uspto How to Scrape USPTO.gov | USPTO Patent & Trademark Web Scraper | Automatio Feb 16, 2026 - Learn how to scrape USPTO.gov for patent and trademark data. Extract patent numbers, inventors, and filing dates for competitive legal intelligence. web scraper automatiopatent trademarkuspto https://ipgen.io/ IPGen AI - Patent & Trademark Filing Made Simple ai patenttrademark filingmade simple https://www.mathys-squire.com/contact-us/munich/ IP Firm - Munich - Patent & Trademark Attorneys - Mathys & Squire Feb 25, 2026 - Looking for intellectual property attorneys in Munich? Our patent and trade mark experts provide legal advice near the EPO and German IP courts. ip firmpatent trademarkmathys squiremunichattorneys https://www.hrfmlaw.com/ intellectual property rights, both domestic and foreign, including patent, trademark, copyright,... intellectual property rightspatent trademarkdomesticforeignincluding https://libguides.library.umaine.edu/ptrc Overview - Patent and Trademark Resource Center - Subject Guides at University of Maine Subject Guides: Patent and Trademark Resource Center: Overview trademark resource centersubject guidesoverviewpatentuniversity https://www.dkpto.org/about-us/processing-of-your-personal-data-by-the-danish-patent-and-trademark-office/processing-of-personal-data-contact-by-phone Processing of personal data when you contact the Danish Patent- and Trademark Office by phone We are the data controller - how do you contact us? The Danish Patent and Trademark Office is data responsible for the processing of the personal... personal datatrademark officeprocessingdanishpatent https://www.oig.doc.gov/about/oversight-areas/u-s-patent-and-trademark-office-pto/?entry=8447 U.S. Patent and Trademark Office (PTO) - Office of Inspector General, U.S. Department of Commerce trademark office ptoinspector general departmentupatentcommerce https://www.oig.doc.gov/about/oversight-areas/u-s-patent-and-trademark-office-pto/?entry=8463 U.S. Patent and Trademark Office (PTO) - Office of Inspector General, U.S. Department of Commerce trademark office ptoinspector general departmentupatentcommerce https://www.ipaustralia.com.au/search-databases-and-tools-google-patents Understanding Google Patents: A Comprehensive Guide to Patent and Trademark Searches in Australia Mar 9, 2026 - Learn About the Process, Benefits, and Services of Patent and Trademark Searches on Google Patents understanding googlecomprehensive guidetrademark searchespatentsaustralia https://www.legalzoom.com/business/intellectual-property/?openChat=true Intellectual Property Protection Online - Trademark and Copyright Registrations, Provisional Patent... Protect your intellectual property with a trademark, copyright, or patent with LegalZoom. Register a trademark or copyright, or apply for a patent easily and... intellectual propertyprotection onlinecopyright registrationsprovisional patenttrademark https://archive.org/details/gov.uspto.patents.application.10719915 USPTO Patents Application 10719915 : United States Patent and Trademark Office : Free Download,... Click the links below to access the documents in this item:10719915-2003-11-20-00001-WCLM pdf stream10719915-2003-11-20-00002-WFEE pdf... united states patentoffice free downloadusptopatentsapplication https://www.uspto.gov/web/offices/pac/mpep/mpep-1000.html 1000 - Matters Decided by Various U.S. Patent and Trademark Office Officials trademark office1000mattersdecidedvarious https://www.oig.doc.gov/about/oversight-areas/u-s-patent-and-trademark-office-pto/?frm-page-1721=3 U.S. Patent and Trademark Office (PTO) - Office of Inspector General, U.S. Department of Commerce trademark office ptoinspector general departmentupatentcommerce https://www.oig.doc.gov/about/oversight-areas/u-s-patent-and-trademark-office-pto/?entry=35775 U.S. Patent and Trademark Office (PTO) - Office of Inspector General, U.S. Department of Commerce trademark office ptoinspector general departmentupatentcommerce https://www.ipaustralia.com.au/types-of-searches-patent-searches Patent and Trademark Searches in Australia: A Comprehensive Guide Mar 9, 2026 - A Guide to Conducting Patent and Trademark Searches and Registering Your Intellectual Property in Australia trademark searchescomprehensive guidepatentaustralia https://www.oig.doc.gov/about/oversight-areas/u-s-patent-and-trademark-office-pto/?entry=43678 U.S. Patent and Trademark Office (PTO) - Office of Inspector General, U.S. Department of Commerce trademark office ptoinspector general departmentupatentcommerce https://public.govdelivery.com/accounts/USPTO/subscriber/new?topic_id=USPTO_3 United States Patent and Trademark Office united states patenttrademark office https://www.uspto.gov/web/offices/com/sol/og/con/ogcon.htm OG Consolidated Listing of Official Gazette Notices Re-Patent and Trademark Office Practices and... official gazette noticestrademark officeogconsolidatedlisting https://www.uspto.gov/about-us/events/grand-opening-university-louisvilles-patent-and-trademark-resource-center POSTPONED: Grand opening of University of Louisville's Patent and Trademark Resource Center | USPTO Learn about Kentucky's IP history and economic drivers, network with entrepreneurs, and learn about the role of IP in fueling creativity at the University of... trademark resource centergrand openinguniversity louisvillepostponedpatent https://www.uspto.gov/learning-and-resources/patent-and-trademark-practitioners?MURL=practitioners Patent and trademark practitioners | USPTO Registered patent practitioners are individuals who have passed the USPTO's registration exam and met the qualifications to represent patent applicants before... patenttrademarkpractitionersuspto https://www.oig.doc.gov/about/oversight-areas/u-s-patent-and-trademark-office-pto/ U.S. Patent and Trademark Office (PTO) - Office of Inspector General, U.S. Department of Commerce trademark office ptoinspector general departmentupatentcommerce https://www.oig.doc.gov/about/oversight-areas/u-s-patent-and-trademark-office-pto/?entry=63425 U.S. Patent and Trademark Office (PTO) - Office of Inspector General, U.S. Department of Commerce trademark office ptoinspector general departmentupatentcommerce https://www.oig.doc.gov/about/oversight-areas/u-s-patent-and-trademark-office-pto/?frm-page-1721=1 U.S. Patent and Trademark Office (PTO) - Office of Inspector General, U.S. Department of Commerce trademark office ptoinspector general departmentupatentcommerce https://www.oig.doc.gov/about/oversight-areas/u-s-patent-and-trademark-office-pto/?entry=68048 U.S. Patent and Trademark Office (PTO) - Office of Inspector General, U.S. Department of Commerce trademark office ptoinspector general departmentupatentcommerce https://archive.org/details/gov.uspto.patents.application.10707067 USPTO Patents Application 10707067 : United States Patent and Trademark Office : Free Download,... Click the links below to access the documents in this item:10707067-2003-11-19-00001-OATH pdf stream10707067-2003-11-19-00002-N417 pdf... united states patentoffice free downloadusptopatentsapplication https://www.oig.doc.gov/about/oversight-areas/u-s-patent-and-trademark-office-pto/?entry=7946 U.S. Patent and Trademark Office (PTO) - Office of Inspector General, U.S. Department of Commerce trademark office ptoinspector general departmentupatentcommerce https://themeim.com/rulify-patent-copyright-trademark-law-firm-wordpress-theme/ Rulify-Patent, Copyright and Trademark Law Firm Mar 16, 2026 - Trademark Company WordPress Theme build with clean code and modern WordPress framework, Bootstrap Lawfirm Theme. It’s suitable for any patent, certification,... patent copyrighttrademark lawfirm https://www.oig.doc.gov/about/oversight-areas/u-s-patent-and-trademark-office-pto/?entry=8394 U.S. Patent and Trademark Office (PTO) - Office of Inspector General, U.S. Department of Commerce trademark office ptoinspector general departmentupatentcommerce https://www.oig.doc.gov/about/oversight-areas/u-s-patent-and-trademark-office-pto/?frm-page-1721=2 U.S. Patent and Trademark Office (PTO) - Office of Inspector General, U.S. Department of Commerce trademark office ptoinspector general departmentupatentcommerce https://store.nolo.com/products/patent-copyright-and-trademark-pctm.html Patent, Copyright & Trademark - Intellectual Property Desk Reference - Nolo This definitive intellectual property desk reference, full of definitions and straightforward explanations, will help you decipher patent, copyright, and... patent copyrightintellectual propertydesk referencetrademarknolo https://www.uspto.gov/learning-and-resources/patent-trademark-resource-centers Patent and Trademark Resource Centers | USPTO A Patent and Trademark Resource Center or PTRC is part of a nationwide network of public, state, and academic libraries designated to support the public with... trademark resourcepatentcentersuspto https://www.legalzoom.com/business/intellectual-property/ Intellectual Property Protection Online - Trademark and Copyright Registrations, Provisional Patent... Protect your intellectual property with a trademark, copyright, or patent with LegalZoom. Register a trademark or copyright, or apply for a patent easily and... intellectual propertyprotection onlinecopyright registrationsprovisional patenttrademark https://patentlawip.com/ Trademark Lawyer Los Angeles | Patent Attorney | Cohen IP Apr 23, 2026 - Los Angeles trademark lawyer and patent attorney helping startups, inventors, and businesses register and protect intellectual property. Call (310) 288-4500. lawyer los angelesattorney cohen iptrademarkpatent https://patentlawip.com/resources/ Intellectual Property Links for Patent and Trademark Offices | Resources Sep 7, 2023 - Check out our awesome list of resources for Patent and Trademark offices. These credible resources have been hand-picked to help you provide you the latest... intellectual propertyoffices resourceslinkspatenttrademark https://info.library.okstate.edu/patent-and-trademark-resource-center Home - Patent and Trademark Resource Center at Oklahoma State University - Guides at Oklahoma State... Guides: Patent and Trademark Resource Center at Oklahoma State University: Home trademark resource centeroklahoma state universitypatentguides https://entrepreneurshipreporter.com/article/908733338-nuwellis-announces-receipt-of-a-notice-of-allowance-from-the-u-s-patent-and-trademark-office-for-innovative-dual-lumen-midline-catheter-technology Nuwellis Announces Receipt of a Notice of Allowance from the U.S. Patent and Trademark Office for... The Entrepreneurship Reporter is an online news publication focusing on sme/smb: Global take on small business news announces receipttrademark officenoticeallowancepatent https://www.oig.doc.gov/about/oversight-areas/u-s-patent-and-trademark-office-pto/?entry=8449 U.S. Patent and Trademark Office (PTO) - Office of Inspector General, U.S. Department of Commerce trademark office ptoinspector general departmentupatentcommerce https://www.oig.doc.gov/about/oversight-areas/u-s-patent-and-trademark-office-pto/?entry=40963 U.S. Patent and Trademark Office (PTO) - Office of Inspector General, U.S. Department of Commerce trademark office ptoinspector general departmentupatentcommerce https://brandip.com/ Creative Business Names, Logos, Trademark, Patent | Brandip creative businesstrademark patentnameslogosbrandip https://www.zacco.com/services/ Services - Patent | Design | Copyright | Trademark | Cybersecurity Feb 16, 2026 - Zacco provides intellectual property protection services including patent prosecution, design protection, copyright and trademark filing and cybersecurity copyright trademarkservicespatentdesigncybersecurity https://www.oig.doc.gov/about/oversight-areas/u-s-patent-and-trademark-office-pto/?entry=65584 U.S. Patent and Trademark Office (PTO) - Office of Inspector General, U.S. Department of Commerce trademark office ptoinspector general departmentupatentcommerce https://www.lib.ncsu.edu/ptrc Patent and Trademark Resource Center | NC State University Libraries NC State University Libraries is currently a Patent and Trademark Resource Center (PTRC). PTRCs are those designated by the U.S. Patent and Trademark Office... trademark resource centernc state universitypatentlibraries https://www.blm.gov/info/notices/drctp-policy Digital Rights, Copyright, Trademark, Patent Policy | Bureau of Land Management Digital Rights, Copyright, Trademark, Patent Policy The BLM fully complies with existing laws and directives that address the digital, copyright, trademark and... digital rightscopyright trademarkpatent policyland managementbureau https://oedci.uspto.gov/OEDCI/ United States Patent and Trademark Office united states patenttrademark office https://www.ghs.com/policies/copyright_patent.html Trademark and Patent Notices patent noticestrademark https://americanewsobserver.com/article/908733338-nuwellis-announces-receipt-of-a-notice-of-allowance-from-the-u-s-patent-and-trademark-office-for-innovative-dual-lumen-midline-catheter-technology Nuwellis Announces Receipt of a Notice of Allowance from the U.S. Patent and Trademark Office for... America News Observer is an online news publication focusing on the United States: Following the news from the United States announces receipttrademark officenoticeallowancepatent https://dame.com/pages/patents-and-trademarks Patent and Trademark Information – Dame Products Patents The following Mating Components’ products are protected by patents in the U.S. and elsewhere. This webpage is provided to satisfy the virtual patent... trademark informationdame productspatent https://www.ynot.com/tag/u-s-patent-and-trademark-office/ U.S. Patent and Trademark Office | YNOT BERLIN/NEW YORK – Pleasure product manufacturer WOW Tech Group released a statement on Tuesday about the company’s “patents and ongoing trademark officeupatentynot https://www.justice.gov/opa/pr/us-patent-and-trademark-office-employee-agrees-pay-500000-resolve-conflict-interest Office of Public Affairs | U.S. Patent and Trademark Office Employee Agrees to Pay $500,000 to... Daxin Wu, a Patent Examiner for the U.S. Patent and Trademark Office (USPTO), has agreed to pay $500,000 to resolve allegations that she violated... public affairs upay 500officepatenttrademark https://maramiya.com/ Maramiya IP – Register Trademark | Patent | Copyright in Qatar | GCC & Middle East trademark patentmiddle eastipregistercopyright https://patentlawip.com/about-us/ Leading Trademark and Patent Attorneys in Los Angeles Oct 9, 2025 - Work with a top trademark attorney Los Angeles clients trust. Our patent attorneys and infringement lawyers protect your brand and innovation. patent attorneyslos angelesleadingtrademark https://www.oig.doc.gov/about/oversight-areas/u-s-patent-and-trademark-office-pto/?entry=8435 U.S. Patent and Trademark Office (PTO) - Office of Inspector General, U.S. Department of Commerce trademark office ptoinspector general departmentupatentcommerce https://library.tamu.edu/wcl/services/index.php Patent and Trademark Resource Center trademark resource centerpatent https://www.oig.doc.gov/about/oversight-areas/u-s-patent-and-trademark-office-pto/?entry=30649 U.S. Patent and Trademark Office (PTO) - Office of Inspector General, U.S. Department of Commerce trademark office ptoinspector general departmentupatentcommerce https://www.amsc.com/copyright-trademark-patent-statement/ Copyright, Trademark & Patent Statement - AMSC copyright trademarkpatentstatementamsc https://public.govdelivery.com/accounts/USPTO/subscriber/new?topic_id=USPTO_30 United States Patent and Trademark Office united states patenttrademark office https://public.govdelivery.com/accounts/USPTO/subscriber/new?topic_id=USPTO_2 United States Patent and Trademark Office united states patenttrademark office https://company360.in/ COMPANY360 Indias #1 portal for Trademark, Copyright, Patent Jan 8, 2026 - Experts in Trademark, Copyright, Number 1 in Trademark Objection Reply and securing your brand with Agreements and contracts. Easy, Fast and Secure at... 1 portaltrademark copyrightindiaspatent https://www.oig.doc.gov/about/oversight-areas/u-s-patent-and-trademark-office-pto/?entry=7947 U.S. Patent and Trademark Office (PTO) - Office of Inspector General, U.S. Department of Commerce trademark office ptoinspector general departmentupatentcommerce https://www.jwp-poland.com/ JWP Patent and Trademark Attorneys Poland, european patent attorney, patent trademark lawyers, law... trademark attorneyslawyers lawjwppatentpoland https://www.uspto.gov/about-us/news-updates/us-patent-and-trademark-office-bring-trademark-and-brand-protection-education U.S. Patent and Trademark Office to bring trademark and brand protection education to NFL Draft® |... The USPTO will bring its name, image, and likeness (NIL) and trademark education to the 2026 NFL Draft® in Pittsburgh, Pennsylvania, April 23 through 25. trademark officebrand protectionupatentbring https://www.nolo.com/legal-encyclopedia/which-protection-do-i-need-patent-copyright-or-trademark.html Which Protection Do I Need: Patent, Copyright, or Trademark? May 7, 2018 - Which form of intellectual property protection is right for you? patent copyrightprotectionneedtrademark https://www.oig.doc.gov/about/oversight-areas/u-s-patent-and-trademark-office-pto/?entry=36709 U.S. Patent and Trademark Office (PTO) - Office of Inspector General, U.S. Department of Commerce trademark office ptoinspector general departmentupatentcommerce https://www.uspto.gov/trademarks/basics/trademark-patent-copyright Trademark, patent, or copyright | USPTO Trademarks, patents, and copyrights are different types of intellectual property, learn the differences between them. trademark patentcopyrightuspto https://www.uspto.gov/learning-and-resources/patent-and-trademark-practitioners Patent and trademark practitioners | USPTO Registered patent practitioners are individuals who have passed the USPTO's registration exam and met the qualifications to represent patent applicants before... patenttrademarkpractitionersuspto https://ipright.vn/ SBLAW - Trademark In Vietnam | Vietnam IP Agent - Patent Attorney SBLaw – Intellctual property law firm was certified by National Office of Intellectual Property (NOIP) under the Vietnam Ministry of Science and Technology... patent attorneytrademarkvietnamipagent https://judiciary.house.gov/committee-activity/hearings/oversight-us-patent-and-trademark-office-2 Oversight of the U.S. Patent and Trademark Office | House Judiciary Committee Republicans office house judiciarycommittee republicansoversightpatenttrademark https://www.oig.doc.gov/about/oversight-areas/u-s-patent-and-trademark-office-pto/?entry=7949 U.S. Patent and Trademark Office (PTO) - Office of Inspector General, U.S. Department of Commerce trademark office ptoinspector general departmentupatentcommerce https://patentlawip.com/blog/uspto-announces-extension-certain-patent-trademark-related-timing-deadlines-coronavirus-aid-relief-economic-security-act/ USPTO announces extension of certain patent and trademark-related timing deadlines under the... Nov 25, 2020 - The United States Patent and Trademark Office (USPTO) today announced extensions to the time allowed to file certain patent and trademark-related documents announces extensionusptocertainpatenttrademark https://www.law360.com/agencies/u-s-patent-and-trademark-office?article_related_content=1 U.S. Patent and Trademark Office : Articles :: Law360 The latest litigation news involving the U.S. Patent and Trademark Office, the government agency trademark officearticles law360upatent https://developer.uspto.gov/ Home | United States Patent and Trademark Office - Open Data Portal united states patentopen data portaltrademark office https://www.nolo.com/legal-encyclopedia/patent-copyright-trademark Patent, Copyright & Trademark patent copyrighttrademark https://patentlawip.com/blog/dental-design-patent-and-trademark-infringement-discus-v-biolase/ Dental Design Patent and Trademark Infringement - Expert Analysis Nov 24, 2020 - Discus Dental had filed a case claiming patent infringement of the design of the Styla in view of a hand-held laser device that Biolase has. Click here to read... design patenttrademark infringementexpert analysisdental