https://linwoodplaza.linwood.wine/wines/Petite-Sirah/All/2020/
2020 Petite Sirah - Linwood Wine at Linwood Plaza
2020 Petite Sirah - Linwood Wine at Linwood Plaza. Search our inventory to find the best 2020 petite sirah at the best prices.
petite sirahlinwoodwineplaza
https://shop.primewineparamus.com/shop/product/teperberg-legacy-petite-sirah-dry-red-wine/5753760a69702d365e70b201?option-id=d1e7fb3e48664738829d8c342a74e1b3c90dcba6d177b71bc55341f12c4dd647
Teperberg Legacy Petite Sirah Dry Red Wine - Prime Wine Cellar, Paramus, NJ
Get Teperberg Legacy Petite Sirah Dry Red Wine from Prime Wine Cellar, Paramus, NJ for $57.5
dry red winepetite sirahparamus njlegacyprime
https://www.wines.com/wineboard/thread-14732-post-61923.html
'99 Fife Redhead Petite Sirah
redhead petitefifesirah
https://www.wineworksonline.com/wines/Petite-Sirah/All/2023/?page=1&varietal=Petite+Sirah&year=2023&sortby=winery&l=10&item_type=wine
2023 Petite Sirah - WineWorks
2023 Petite Sirah - WineWorks. Search our inventory to find the best 2023 petite sirah at the best prices.
petite sirah
https://delectable.com/wine/apothic/apothic-crush-limited-release-california-petite-sirah-pinot-noir/2013
2013 Apothic Apothic Crush Limited Release California Petite Sirah Pinot Noir
A red wine produced by Apothic. A blend of Pinot Noir and Petite Sirah from California, USA.
limited releasepetite sirahpinot noirapothiccrush
https://chanswineworld.com/shop/product/legacy-petite-sirah-750ml/684872dd0b9f686a309f331f?option-id=e45938c026b368cf79747d6b3eb20a9a35e2df5b467753e01069382bec7f216a
Legacy Petite Sirah 750ml - Wine World - Wine & Spirits
petite sirahwine worldlegacyspirits
https://bronsonliquors.com/shop/product/mettler-petite-sirah/56eba70f69702d5654852900?option-id=fd73b241bdf21f3648017d3f709136de94afc94817b8a46bd9fbf37dd282d94b
Mettler Petite Sirah - Bronson Liquors
METTLER Petit Syrah is a red wine known for its concentrated flavors and full body. It often exhibits aromas of blackberry, clove, and toasty oak, leading to a...
petite sirahmettlerbronsonliquors
https://www.winecountryconnection.net/shop/2013-t-vine-napa-valley-petite-sirah
2013 T-VINE "NAPA VALLEY" PETITE SIRAH | Wine Country Connection
2013 T-VINE "NAPA VALLEY" PETITE SIRAH Winery Notes: "A powerful core of huckleberry, boysenberry, dark chocolate and blueberry flavors. Good acidity and silky...
napa valleypetite sirahwine countryvineconnection
https://www.wtso.com/blog/tag/petite-sirah/
petite sirah Archives - From The Vine
petite sirahfrom thearchivesvine
https://wikiliq.org/wine/j-lohr-vineyard-series-tower-road-petite-sirah/
J. Lohr Vineyard Series Tower Road Petite Sirah: Price, Ratings & Reviews | Order Online
Apr 19, 2021 - Check out the J. Lohr Vineyard Series Tower Road Petite Sirah Description, Prices, Reviews, and Ratings. Order now and Have Wine Delivered to your door in...
j lohrpetite sirahorder onlinevineyardseries
https://lakevilleliquors.com/shop/product/inkblot-petite-sirah/606b33bdc128c83afbf2c642?option-id=625aa4ec58f1b1fbd1b5fa60b5c7744a1baacdb95c3c813ef69a85026bddb142
Michael David, Ink Blot Petite Sirah 2021 - Lakeville Liquors
Get Michael David, Ink Blot Petite Sirah 2021 from Lakeville Liquors for $31.99
michael davidink blotpetite sirahlakevilleliquors
https://binfy.com/food_nutrition.php?id=14103&foodcat_id=1400
Nutrition Facts for Alcoholic Beverage, wine, table, red, Petite Sirah | Binfy.com
Nutritional information and calories in Alcoholic Beverage, wine, table, red, Petite Sirah, including total fat, protein, cholesterol, carbohydrates, vitamins,...
nutrition factsalcoholic beveragepetite sirahwinetable
https://www.liquorlandgroup.com/shop/product/caymus-suisun-grand-durif-petite-sirah/5ada7d8d33e88928f50e1d9b?option-id=6b04dda046fd41dcbe11f2879672c97ee49de5dca4d712758f2fa035f0a86753
Caymus Suisun Grand Durif Petite Sirah - LiquorLand NJ with 5 locations. Shop in-store or online
Coming from the Wagner family, Grand Durif features a deep, majestic purpose. The nose has notes of blueberries and earthy tones, while vanilla notes from oak...
shop in storepetite sirahcaymusgrandliquorland
https://shoppersdiscountliquor.com/shop/product/caymus-suisun-grand-durif-red/5ada7d8d33e88928f50e1d9b?option-id=5e14df716318d453cacbe37cec31e4952bdd1b98c2cc05d65ab391cb86724ef5
Caymus Suisun Grand Durif Petite Sirah - Shoppers Discount Liquors, Parsippany Troy Hills, NJ,...
Coming from the Wagner family, Grand Durif features a deep, majestic purpose. The nose has notes of blueberries and earthy tones, while vanilla notes from oak...
petite sirahcaymusgrandshoppersdiscount
https://bottlerocket.com/shop/product/san-simeon-petite-sirah/576ddd4f69702d3b3c455f01?option-id=462424b97cdb10594306324f3c3fa2de5b178ce097227fdb824b11a1069cb49a
San Simeon Petite Sirah - Bottlerocket Wine & Spirit, New York, NY
San Simeon Petite Sirah is fermented and aged in our state-of-the-art winery. Beginning life in our sustainably-grown vineyards, the best lots from each estate...
new york nysan simeonpetite sirahwinespirit
https://villagesqliquors.com/shop/product/bianchi-signature-paso-robles-petite-sirah/5a6b78240abe0a3d52569ffb?option-id=b640eec29b0fec2a7c01f7239ca2302c58f7585370ea9d50193a12923575f2d7
Bianchi Signature Paso Robles Petite Sirah - Village Square Liquors Andover MA, Andover, MA
Get Bianchi Signature Paso Robles Petite Sirah from Village Square Liquors Andover MA, Andover, MA for $25.99
paso roblespetite sirahvillage squareandover mabianchi
https://regencyliquor.com/shop/product/lava-cap-petite-sirah-reserve/5b62fb058f58763a2f3c5c8c?option-id=20c21427f8e9a6c2513a05d73b4333547165cd512b81dee481c7a1f6a4a18445
LAVA CAP PETITE SIRAH RESERVE - Regency Wine & Liquor, Winter Garden, FL, Winter Garden, FL
A Wine and Liquor (Spirits) store located in 16100 Marsh Rd #201, Winter Garden, FL 34787, USA
petite sirahwinter gardenlavacapreserve
https://vintnerwinemarket.com/shop/product/caymus-suisun-grand-durif-petite-sirah/5ada7d8d33e88928f50e1d9b?option-id=c81be95dc5667bfe43ac038e1f1249fda22c66cbf5225b1556d71b23710643a7
Caymus Suisun Grand Durif Petite Sirah - Vintner Wine Market Charlotte NC, Charlotte, NC
Coming from the Wagner family, Grand Durif features a deep, majestic purpose. The nose has notes of blueberries and earthy tones, while vanilla notes from oak...
petite sirahwine marketcharlotte nccaymusgrand
https://pecoswineandspirits.com/shop/product/mcmanis-family-vineyards-petite-sirah/56c3376869702d27ed290800?option-id=605966b8046a0c65b6bfbe82bcb92d2c342207797d5f8562365d6549de875490
McManis Family Vineyards Petite Sirah - Pecos Wine & Spirits, Denver, CO, Denver, CO
Full-bodied with a rich purple color, our Petite Sirah leads with flavors of dark chocolate, caramel, and juicy black fruit. The grapes for our Petite Sirah...
petite sirahdenver comcmanisfamilyvineyards
https://www.joecanalshammonton.com/wines/Petite-Sirah/?price_band=25&item_type=red&size=750
Petite Sirah Wine between $10 and $25 (750ml) - Joe Canal's Discount Liquor Outlet of Hammonton
Petite Sirah Wine between $10 and $25 (750ml) - Joe Canal's Discount Liquor Outlet of Hammonton. Search our inventory to find the best petite sirah wine...
petite sirahwinejoecanaldiscount
https://winelegend.com/shop/product/c-hughes-lot-339-red-field-blend-zin-petite-sirah-syrah/5b57b5ad8f587649f1879327?option-id=3f2a258fa830477c1b02a51f7a81103a61f1cd4ba00a97cd16f394d9898a0cd0
C Hughes Lot 339 Red Field Blend Zin Petite Sirah Syrah - Wine Legend, Livingston, NJ.A Premium...
Get C Hughes Lot 339 Red Field Blend Zin Petite Sirah Syrah from Wine Legend, Livingston, NJ.A Premium Wine Spirits and Beer store, Livingston, NJ for $10.97
red fieldpetite sirahchugheslot
https://pecosliquors.com/shop/product/stags-leap-winery-petite-sirah/56703bf375627550508a0500?option-id=353915871cbd0b044db26be3a27c3bf972f135ac2897b5945c20699a3a523159
Stags' Leap Winery Petite Sirah - Peco's Liquor Store, Wilmington, DE
This Petite Sirah is crafted with fruit from northern vineyards in Calistoga and St. Helena and southern vineyards in Oakville, Oak Knoll and Coombsville. This...
stags leap winerypetite sirahliquor storewilmington depeco
https://www.shopperswines.com/wines/41%25-Petite-Sirah/All/2017/California/?page=1&varietal=41%25+Petite+Sirah&year=2017&sortby=winery®ion=California&l=50&item_type=wine
2017 California 41% Petite Sirah - Shoppers Wines
2017 California 41% Petite Sirah - Shoppers Wines. Search our inventory to find the best 2017 california 41% petite sirah at the best prices.
petite sirahcaliforniashopperswines
https://lushwineandspirit.com/shop/product/j-lohr-tower-road-petite-sirah/5995e879356551215755e81b?option-id=62a03e21d3f5d58f7bc212eb6c7b5a84c3f236086e1a9ae3dd4536d57ca607f9
J. Lohr Tower Road Petite Sirah - Lush wine beer & Spirits, Asbury Park, NJ, Asbury Park, NJ
In the vineyards surrounding Tower Road, in the Estrella district of Paso Robles, our Petite Sirah thrives on the well-drained yet heavier clay soils of the...
asbury park njpetite sirahlohrtowerroad
https://shop.grizzlyliquor.com/wines/Bianchi-Bianchi-Petite-Sirah-w5188101if
Bianchi Petite Sirah - Grizzly Liquor
Bianchi Petite Sirah available at Grizzly Liquor in Missoula, MT
petite sirahbianchigrizzlyliquor
https://pascaleswineandliquors.com/shop/product/high-west-cask-collection-petite-sirah-finish/66832a32f72bfb4b480e2d5e?option-id=b18085f3a67ece8b296162b492c3b29c36b5a4a3be3151a97259770bc6658716
High West Cask Collection Petite Sirah Finish - Pascale's Wine & Liquors, Fayetteville, NY,...
high westcask collectionpetite sirahfinishwine
https://thespiritshoppe.com/shop/product/mcmanis-family-vineyards-petite-sirah/56c3376869702d27ed290800?option-id=605966b8046a0c65b6bfbe82bcb92d2c342207797d5f8562365d6549de875490
McManis Family Vineyards Petite Sirah - The Spirit Shoppe, Deerfield, MA
Full-bodied with a rich purple color, our Petite Sirah leads with flavors of dark chocolate, caramel, and juicy black fruit. The grapes for our Petite Sirah...
petite sirahthe spiritmcmanisfamilyvineyards
https://antiochwine.com/shop/product/parducci-true-grit-petite-sirah-reserve-mendocino/573a51c869702d19663dd300?option-id=f27af854e40fc17c901e38d72330a62136832648e93756546cfd551c8fbaaedb
Parducci 'True Grit' Petite Sirah Reserve Mendocino - Antioch Fine Wine and Liquors, Antioch, IL
The True Grit Reserve Petite Sirah has heady aromas of ripe fruit, white pepper and vanilla, followed by an intense rush of fresh blackberry, dark chocolate,...
true gritpetite sirahfine wineparduccireserve
https://hdspirits.com/shop/product/mcmanis-family-vineyards-petite-sirah/56c3376869702d27ed290800?option-id=605966b8046a0c65b6bfbe82bcb92d2c342207797d5f8562365d6549de875490
McManis Family Vineyards Petite Sirah - HD WINE SPIRITS+, Roswell, GA, Roswell, GA
Full-bodied with a rich purple color, our Petite Sirah leads with flavors of dark chocolate, caramel, and juicy black fruit. The grapes for our Petite Sirah...
petite sirahroswell gamcmanisfamilyvineyards
https://www.vinomas.com/Bourbon-walnut-pistachio-chicken-paired-with-Bianchi-Petite-Sirah
Bourbon Walnut, Pistachio Chicken paired with Bianchi Petite Sirah - Vino Mas
Bourbon Walnut, pistachio Chicken paired with Bianchi Petite Sirah
petite sirahbourbonwalnutpistachiochicken
https://www.atomicliquorsmn.com/shop/product/j-lohr-tower-road-petite-sirah/5995e879356551215755e81b?option-id=e6f2d9480209e8d871f2f913007fdcab9262a13210371986eab184ce57ae44c0
J. Lohr Tower Road Petite Sirah - Atomic Liquors, Eagan, MN, Eagan, MN
In the vineyards surrounding Tower Road, in the Estrella district of Paso Robles, our Petite Sirah thrives on the well-drained yet heavier clay soils of the...
j lohrpetite sirahatomic liquorseagan mntower
https://baytownewine.com/wine/red-wine/petite-sirah/parducci-petite-sirah
Parducci Petite Sirah | BayTowne Wine & Spirits
petite sirahparducciwinespirits
https://thirdbasemarketandspirits.com/shop/product/epiphany-petite-sirah-rodneys-vineyards-santa-barbara-county/5af5b33a5065c123f525457d?option-id=43ef28ec86a3729f7021913207dcb3952360fa49376ceec31f093bfee280eb7d
Epiphany Petite Sirah Rodneys Vineyards Santa Barbara County - Third Base Market & Spirits: Top...
Epiphany Petite Sirah 2020 750mL Product Description A boutique Petite Sirah from Santa Barbara County's Santa Ynez Valley, showcasing the region's ability to...
santa barbara countypetite sirahthird baseepiphanyrodneys
https://www.wsjwine.com/product/lustrum-petite-sirah-2023/4441023
Lustrum Petite Sirah 2023
From sun-drenched Lodi, California and grapes grown by fifth-generation farmers, Lustrum Petite Sirah is a voluptuous and fruit-forward, full-bodied red sure...
petite sirahlustrum
https://winegeeks.com/wines/814.html
Guenoc Petite Sirah Guenoc Valley 2001 Wine - Winegeeks
petite sirahvalleywine
https://www.americaswineshop.com/shop/product/stags-leap-winery-petite-sirah/56703bf375627550508a0500?option-id=353915871cbd0b044db26be3a27c3bf972f135ac2897b5945c20699a3a523159
Stags' Leap Winery Petite Sirah - McAdam Buy-rite, New York, NY
This Petite Sirah is crafted with fruit from northern vineyards in Calistoga and St. Helena and southern vineyards in Oakville, Oak Knoll and Coombsville. This...
stags leap winerynew york nypetite sirahmcadambuy
https://www.winebusiness.com/classifieds/grapesbulkwine/?go=listing&listingid=306358&ref=rn
Premium Bulk 2025 Petite Sirah
Classifieds listings for the wine industry
petite sirahpremiumbulk
https://www.yianniswine.com/wines/Petite-Sirah/All/2019/Stags-Leap-District/?region=Stags+Leap+District
2019 Stags Leap District Petite Sirah - Yiannis Wine Shop
2019 Stags Leap District Petite Sirah - Yiannis Wine Shop. Search our inventory to find the best 2019 stags leap district petite sirah at the best prices.
petite sirahwine shopstagsleapdistrict
https://www.bluestreakwine.com/wines/Petite-Sirah/United-States/All/Mendocino/?region=Mendocino&item_type=sparkling&size=750
Mendocino Petite Sirah Wine (750ml) - Blue Streak Wines & Spirits
We have definite thoughts on the wines we have and pay special attention to what our customers want. We choose wines based first and foremost on how tasty...
petite sirahblue streakmendocinowinespirits
https://allstarwine.com/shop/product/caymus-suisun-grand-durif-petite-sirah/5ada7d8d33e88928f50e1d9b?option-id=f0b584ab7ac479218416a5c47cb71cdff6b505c4b8bbc4fcdc73ea351a2979af
Caymus Suisun Grand Durif Petite Sirah - All Star Wine & Spirits, Latham, NY, Latham, NY
Coming from the Wagner famliy, Grand Durif features a deep, magestic purpose. Durif is synonymous with Petite Sirah, the widely grown grape in the region. With...
petite sirahall starcaymusgrandwine
https://mainewine.com/wines/petite-sirah/petite-sirah-2013-2/
Petite Sirah 2013 - Cellardoor Winery
petite sirahwinery
https://a1liquors.net/shop/product/caymus-suisun-grand-durif-petite-sirah/5ada7d8d33e88928f50e1d9b?option-id=c81be95dc5667bfe43ac038e1f1249fda22c66cbf5225b1556d71b23710643a7
Caymus Suisun Grand Durif Petite Sirah - A-1 Liquors
Coming from the Wagner family, Grand Durif features a deep, majestic purpose. The nose has notes of blueberries and earthy tones, while vanilla notes from oak...
petite sirahcaymusgrandliquors
https://www.marcelocopello.com/vinho/bougainville-petite-sirah
Bougainville Petite Sirah 2012, Santa Rita,
Bougainville Petite Sirah 2012, Santa Rita, Maipo-Chile (Wine Brands, www.winebrands.com.br).
petite sirahsanta ritabougainville
https://www.taphunter.com/beverage/criss-cross-petite-sirah/5902590277320704
Criss Cross Petite Sirah from Criss Cross - Where it's available near you - TapHunter
Criss Cross Petite Sirah from Criss Cross - Petite Sirah - Where it's available near you
criss crosspetite sirahnear youavailable
https://zinfandelchronicles.com/2012/08/petite-sirah-californias-most-age-worthy-varietal/
Petite Sirah: California's Most Age Worthy Varietal? | Zinfandel Chronicles
Dec 30, 2014 - Petite Sirah was first bottled as its own varietal by Concannon in 1961. The wines made in these early years were huge, tannic, extracted wines. Some of the...
petite sirahcaliforniaageworthyvarietal
https://passionvines.com/shop/product/old-soul-petite-sirah/58afc5a801ff9523117916ed?option-id=31eb1845c782c3dcdd59cd172c77d114948871f07dbcaf0ea44bc8e5e86a1587
Old Soul Petite Sirah - Passion Vines Wine & Spirit Company, Egg Harbor Township, NJ
OLD SOUL PETITE SIRAH SINGLE 750 ML BTL - GLASS
egg harbor townshippetite sirahpassion vinesoldsoul
https://www.beaconwine.com/wines/Petite-Sirah/United-States/2017/?price_band=75
2017 United States Petite Sirah between $50 and $75 - Beacon Wine & Spirits
united statespetite sirahbeaconwinespirits
https://www.supercellars.com/wines/Parducci-Petite-Sirah-Mendocino-County-2020-w1766856e3
Parducci - Petite Sirah Mendocino County 2020 - Super Cellars - Ridgewood, NJ
petite sirahmendocino countyparduccisupercellars
https://thewineauthorityli.com/shop/product/johnny-q-petite-sirah/5d9d2469b741975f295af300?option-id=d19f12d0172529abef9ce89f9a034c6fb897c6abd1ae8e71ddd5868b1c3535ab
Johnny Q Petite Sirah - The Wine Authority, Mount Sinai, NY, Mount Sinai, NY
Though midnight black at the core, this wine is impressively fruit-driven on the nose with oodles of ripe blackberry and cassis aromas. The round palate tacks...
petite sirahthe winemount sinaijohnnyq
https://skylinebroadway.com/shop/product/san-simeon-petite-sirah/576ddd4f69702d3b3c455f01?option-id=c470c53e3cd9f826234924915d9a5b20b60855cac3017503fe6a8f533e0d5e3d
San Simeon Petite Sirah - Skyline Liquor Mesa & Casa Grande, AZ
San Simeon Petite Sirah is fermented and aged in our state-of-the-art winery. Beginning life in our sustainably-grown vineyards, the best lots from each estate...
casa grande azsan simeonpetite sirahskylineliquor
https://bigredliquors.com/shop/product/stags-leap-winery-petite-sirah/56703bf375627550508a0500?option-id=353915871cbd0b044db26be3a27c3bf972f135ac2897b5945c20699a3a523159
Stags' Leap Winery Petite Sirah 700ML - Big Red Liquors
This Petite Sirah is crafted with fruit from northern vineyards in Calistoga and St. Helena and southern vineyards in Oakville, Oak Knoll and Coombsville. This...
stags leap winerypetite sirahbig redliquors
https://liquorama.com/stokes-ghost-monterey-petite-sirah-2020.html
Stokes' Ghost Monterey Petite Sirah | Shop at Liquorama
Discover Stokes' Ghost Monterey Petite Sirah, a bold and full-bodied red wine with dark fruit and spice from Monterey.
petite sirahshop atstokesghostmonterey
https://healthylivingmarket.com/tag/petite-sirah/
petite sirah - Healthy Living
Bacon and pasta combinations are a healthy meal idea that can be prepared with just a limited number of pantry ingredients. Garlic pasta recipe|Healthy Living
petite sirahhealthy living
https://labelpeelers.com/wine-making/wine-kits/finer-wine-kits/all-finer-wine-kits/copy-of-petite-sirah-wine-kit-artisan/?searchid=0&search_query=corks+30
Petite Sirah Wine Kit, Prodigy
Buy Petite Sirah Wine Kit, Prodigy. Label Peelers is proud to offer Finer Wine Kits brand of products. SKU: FWK-PRO-PETSIR in new condition.
petite sirahwinekitprodigy
https://avonwines.com/shop/product/shannon-ridge-high-elevation-petite-sirah-2023-750ml/56c337e269702d27ed970e00?option-id=d5f968144638e34872fc26eb2cc3ac1c31ccaf1e3e2edc483244a5eeca5ee00b
SHANNON RIDGE HIGH ELEVATION PETITE SIRAH 2023 750ML - Avon Wines & Spirits, Avon, CT, Avon, CT
This full-bodied wine offers big, ripe flavors and smooth tannins. It's approachable for Petite Sirah, and packed with dark chocolate and black pepper notes...
petite sirahshannonridgehighelevation
https://wine-by-benito.blogspot.com/2007/04/2002-jewel-petite-sirah.html
Benito's Wine Reviews: 2002 Jewel Petite Sirah
I love Petite Sirah, and while it's starting to be taken more seriously, it's still possible to get decent bargain bottles. For instance, t...
wine reviewspetite sirahbenitojewel
https://florhamparkliquor.com/shop/product/stags-leap-winery-petite-sirah/56703bf375627550508a0500?option-id=353915871cbd0b044db26be3a27c3bf972f135ac2897b5945c20699a3a523159
Stags' Leap Winery Petite Sirah - Florham Park Liquors Florham Park NJ, Florham Park, NJ
This Petite Sirah is crafted with fruit from northern vineyards in Calistoga and St. Helena and southern vineyards in Oakville, Oak Knoll and Coombsville. This...
stags leap winerypetite sirahflorham parkliquorsnj
https://sandyswine.com/shop/product/saracina-petite-sirah-750-ml/68252cee54cee430b6a9f7f6?option-id=ea7af07e272e14c8596c99018801c245d58e177dd9d25c3f88dd997b6c8a5e23
Saracina Petite Sirah 750 Ml - Sandy's Wine & Spirits
petite sirahmlsandywinespirits
https://www.chapelhillwinecompany.com/wines/Petite-Sirah/United-States/All/California/?page=1&varietal=Petite+Sirah&country=United+States&winery=Ridge+Vineyards&sortby=winery®ion=California&l=100&item_type=wine
California Petite Sirah Ridge Vineyards - Chapel Hill Wine Company
California Petite Sirah Ridge Vineyards - Chapel Hill Wine Company. Search our inventory to find the best california petite sirah ridge vineyards at the best...
petite sirahridge vineyardschapel hillcaliforniawine
https://troutliquors.com/shop/product/criss-cross-petite-sirah/59f5c3ac644576213f347d77?option-id=59aa843b4be9c0c030f5e8b04d4cb072667e64c2a7c6cd8fdd2c4427f469c3b0
Criss Cross Petite Sirah - Trout Liquors I Frederick MD, Frederick, MD
We criss cross different vineyards to find the very best fruit for this lush wine. Petite Sirah is known for its inky, dark color which is present almost...
criss crosspetite sirahfrederick mdtroutliquors
https://glencoewineandspirits.com/shop/product/parducci-small-lot-petite-sirah/56eb8c3c69702d56546a0b00?option-id=724545a6deca89c88fbc8766ee0e62c59c0fc094b28bd9a4f96fe9de5062ced1
Parducci Small Lot Petite Sirah - Glencoe Wine & Spirits Glencoe MN, Glencoe, MN
Dark ruby in color with aromas of cherry, blackberry, mint, and chocolate, this big red is spicy, with dark fruit flavors and supple tannins. Aged 20 months in...
petite sirahparduccismalllotglencoe
https://www.napavalleywineandcigar.com/mm5/merchant.mvc?Screen=CTGY&Category_Code=8&Session_ID=2084f4452f730de1a70cd74407e1dfd5
California Petite Sirah: Napa Valley Wine & Cigar
napa valley winepetite sirahcaliforniacigar
https://jebdunnuck.com/wines/735926/
2022 Carlisle Petite Sirah Palisades Vineyard
petite sirahcarlislepalisadesvineyard
https://winebazaar.com/shop/product/bogle-petite-sirah/5521cefb65613100038f0300?option-id=254bd87d087fa1e81eb56bd65f885b0d636cafec459e29af91d288373ac0db96
Bogle Petite Sirah - HOUSE OF WINE AND SPIRITS LLC New Rochelle NY, New Rochelle, NY
wine and spiritsnew rochelle nypetite sirahboglehouse
https://frederickwinehouse.com/shop/product/cloud-break-petite-sirah/5b8ed6efb77cb3601d9bab1e?option-id=e5ed2725c72d4646a2652336f777bd06d24d4c7ce8744c1ea1ff9adf3f907eca
Cloud Break Petite Sirah - Frederick Wine House, Frederick, MD, Frederick, MD
The Cloud Break Petite Sirah has intense ripe blackberry and plum aromas. Its trademark inky, jammy features are accented by layers of spice and complexity....
petite sirahhouse mdcloudbreakfrederick
https://villagevintnernyc.com/shop/product/caymus-suisun-grand-durif-petite-sirah/5ada7d8d33e88928f50e1d9b?option-id=9e5da756791533cef16f5594df6ab921d91047a586c8fd1189bc7033629d2079
Caymus Suisun Grand Durif Petite Sirah - Village Vintner, New York, NY, New York, NY
Coming from the Wagner family, Grand Durif features a deep, majestic purpose. The nose has notes of blueberries and earthy tones, while vanilla notes from oak...
new york nypetite sirahcaymusgrandvillage
https://www.harryswine.com/websearch_results.html?varietal=Petite+Sirah&winery=Bogle&sortby=winery®ion=California&l=25&item_type=red
California Petite Sirah Bogle - Harry's Wine & Liquor Market
petite sirahcaliforniabogleharrywine
https://marylandwinehouse.com/shop/product/johnny-q-petite-sirah/5d9d2469b741975f295af300?option-id=d19f12d0172529abef9ce89f9a034c6fb897c6abd1ae8e71ddd5868b1c3535ab
Johnny Q Petite Sirah - Maryland Wine House Hagerstown MD, Hagerstown, MD
Though midnight black at the core, this wine is impressively fruit-driven on the nose with oodles of ripe blackberry and cassis aromas. The round palate tacks...
petite sirahhagerstown mdjohnnyqmaryland
https://www.wildrivergrille.com/menu-item/runquist-petite-sirah/
Runquist Petite Sirah - Wild River Grille
Oct 8, 2023 - Clarksburg 2021 Price: 68
petite sirahwildrivergrille
https://seattleliquordelivery.com/shop/product/vinum-cellars-petite-sirah/587f77ea39e21c1a7a4e0aef?option-id=2e6a94e03f7b04763695b914cb9e6edb625d9a7cae5826198b15759953bd14f8
Vinum Cellars Petite Sirah - West Seattle Liquor and Wine, Seattle, WA, Seattle, WA
Get Vinum Cellars Petite Sirah from West Seattle Liquor and Wine, Seattle, WA, Seattle, WA for $15.5
petite sirahwest seattlevinumcellarsliquor
https://www.haskells.com/bogle-petite-sirah/?searchid=0&search_query=rustic+rotor
Bogle Petite Sirah - Haskell's Wine & Spirits
petite sirahboglehaskellwinespirits
https://www.mycanals.com/websearch_results.html?item_type=wine&varietal=Petite+Sirah
Petite Sirah - Canal's Discount Liquors of Mt. Ephraim
Petite Sirah - Canal's Discount Liquors of Mt. Ephraim. Search our inventory to find the best petite sirah at the best prices.
petite sirahmt ephraimcanaldiscountliquors
https://newwestlanewines.com/shop/product/stags-leap-winery-petite-sirah/56703bf375627550508a0500?option-id=353915871cbd0b044db26be3a27c3bf972f135ac2897b5945c20699a3a523159
Stags' Leap Winery Petite Sirah - New Westlane Wines & Liquors, New York, NY, New York, NY
This Petite Sirah is crafted with fruit from northern vineyards in Calistoga and St. Helena and southern vineyards in Oakville, Oak Knoll and Coombsville. This...
stags leap winerypetite sirahnewwinesliquors
https://sommelierschoiceawards.com/en/winner-brands/wines/2023/monserate-vineyards-winery-1971/petite-sirah-6213.htm
Petite Sirah from United States - Winner of Silver medal at the Sommeliers Choice Awards
from united statessommeliers choice awardspetite sirahsilver medalwinner
https://maximumbev.com/shop/product/old-soul-petite-sirah/58afc5a801ff9523117916ed?option-id=d880ea1741d092b5cc445290e0166a13779a3d28bcc8e0bfdbf16c62707ff898
Old Soul Petite Sirah - Maximum Beverage
OLD SOUL PETITE SIRAH SINGLE 750 ML BTL - GLASS
petite siraholdsoulmaximumbeverage
https://www.foodsel.com/food/view/alcoholic-beverage-wine-table-red-petite-sirah/details/
Foodsel - Alcoholic Beverage, wine, table, red, Petite Sirah
alcoholic beveragepetite sirahwinetablered
https://www.everythingwine.ca/maggio-petite-sirah
Maggio Petite Sirah 750 mL
Shop Maggio Petite Sirah 750 mL online at Everything Wine. Enjoy in-store pickup or delivery available across British Columbia.
petite sirahmaggioml
https://www.woodswine.com.br/santa-rita-bougainville-petite-syrah-2020
BOUGAINVILLE PETITE SIRAH SANTA RITA 2021 - WoodsWine - Bebidas Premium - Entregamos para todo o...
SANTA RITA BOUGAINVILLE PETITE SYRAH 2020
petite sirahsanta ritabougainvillebebidaspremium
https://tableandvine.com/shop/product/spellbound-petite-sirah/56ca62997562752ed56e0700?option-id=c795cfbefbeb253132a9482779e4f62db6f1e47b497477131ba57d3a969e5fc7
Spellbound Petite Sirah - 4000 Wines, 3500 Spirits, 3500 Beers. Shipping in Massachusetts., West...
Spellbound Petite Sirah has an intense color and generous bouquet of rich blackberries and blueberries, vanilla bean and roasted coffee, all in a remarkably...
petite sirahin massachusettsspellboundwinesspirits
https://napa.guides.winefolly.com/wineries/the-terraces/wines/petite-sirah/vintages/VT-XUVMSTPWC/
The Terraces Petite Sirah 2018 | The Terraces Wines | Napa Valley Wineries | Wine Folly
The Terraces Petite Sirah 2018 | The Terraces Wines | Napa Valley Wineries | Napa Valley Wine Regions
napa valley wineriesthe terracespetite sirahwinesfolly
https://shop.corkliquor.com/shop/product/parducci-small-lot-petite-sirah/56eb8c3c69702d56546a0b00?option-id=724545a6deca89c88fbc8766ee0e62c59c0fc094b28bd9a4f96fe9de5062ced1
Parducci Small Lot Petite Sirah - Cork Liquors, Columbus, IN
Dark ruby in color with aromas of cherry, blackberry, mint, and chocolate, this big red is spicy, with dark fruit flavors and supple tannins. Aged 20 months in...
petite sirahcolumbus inparduccismalllot
https://www.edsfinewines.com/wine-store/wine/red-wine/petite-sirah-petite-durif/robert-foley-vineyards-petite-sirah/
Robert Foley Vineyards Petite Sirah - Ed's Fine Wines
Apr 17, 2021 - This 100% Petite Sirah is a truly fruit-focused bottling. Blackberry pie, briar and camphor notes interplay in the aromas and flavors that flood the palate in...
robert foleypetite sirahfine winesvineyardsed
https://www.mickyfinns.com/websearch_results.html?item_type=wine&varietal=Petite+Sirah
Petite Sirah - Micky Finn's
Petite Sirah - Micky Finn's. Search our inventory to find the best petite sirah at the best prices.
petite sirahmickyfinn
https://event.webinarjam.com/3qnx0/register/xnkmlc4
Winephabet Street Season 2-P is for Petite Sirah
Grab a glass and join Lori and Debbie as they take you through the world of wine one letter at a time. This month we explore the Petite Sirah
petite sirahstreetseason
https://natickwineandspirits.com/shop/product/mcmanis-family-vineyards-petite-sirah/56c3376869702d27ed290800?option-id=605966b8046a0c65b6bfbe82bcb92d2c342207797d5f8562365d6549de875490
McManis Family Vineyards Petite Sirah - Natick Wines & Spirits Natick MA, Natick, MA
Full-bodied with a rich purple color, our Petite Sirah leads with flavors of dark chocolate, caramel, and juicy black fruit. The grapes for our Petite Sirah...
petite sirahmcmanisfamilyvineyardsnatick
https://21stamendment.com/shop/product/stags-leap-petite-sirah-19-75/6474ee1836c37c27481afd2c?option-id=1d7ce54a3451a206bcb8b8c4d836b98959309dc0aedbd8f6f09d00df43277e71
Stags Leap Petite Sirah 19 75 - 21st Amendment Wine & Spirits
petite sirahstagsleapamendmentwine
https://jacobliquorwest.com/shop/product/old-soul-petite-sirah/58afc5a801ff9523117916ed?option-id=d880ea1741d092b5cc445290e0166a13779a3d28bcc8e0bfdbf16c62707ff898
Old Soul Petite Sirah - Jacob Liquor West Wichita, Wichita, KS
OLD SOUL PETITE SIRAH SINGLE 750 ML BTL - GLASS
petite sirahwichita ksoldsouljacob
https://www.marketviewliquor.com/product/mcmanis-petite-sirah-750-ml
McManis Petite Sirah / 750 ml - Marketview Liquor
Browse our extensive selection of wine today. We offer the perfect wine selection for every occasion. Buy our wine online and have it delivered today!
petite sirahmcmanismlmarketviewliquor
https://fivestarliquorwine.com/shop/product/black-bear-red-chair-petite-sirah/573f9fb869702d34f5214400?option-id=c8345148ab7606cb08c98809942b56a1b0c621412614664d2ffb7a506cbc5e21
Black Bear Red Chair Petite Sirah - Five Star Liquor & Wine Queens NY, Queens, NY
black bearpetite sirahfive starqueens nyred