Robuta

https://www.nextflow.io/ A DSL for parallel and scalable computational pipelines | Nextflow Nextflow enables scalable and reproducible scientific workflows using software containers. It allows the adaptation of pipelines written in the most common... dslparallelscalablecomputationalpipelines https://github.com/zenml-io/zenml GitHub - zenml-io/zenml: ZenML 🙏: One AI Platform from Pipelines to Agents. https://zenml.io. ·... ZenML 🙏: One AI Platform from Pipelines to Agents. https://zenml.io. - zenml-io/zenml one ai platform https://github.com/airbytehq/airbyte GitHub - airbytehq/airbyte: Open-source data movement for ELT pipelines and AI agents — from APIs,... https://arxiv.org/abs/2310.03714 [2310.03714] DSPy: Compiling Declarative Language Model Calls into Self-Improving Pipelines Abstract page for arXiv paper 2310.03714: DSPy: Compiling Declarative Language Model Calls into Self-Improving Pipelines language model https://www.pipelinesconference.org/ Home | UESI Pipelines Conference pipelinesconference https://maia-staging-site.webflow.io/enterprise/roadmap-acceleration Accelerate AI Roadmap with Automated Data Pipelines | Maia Accelerate pipeline delivery by up to 10× with agentic AI. Gain the freedom to scale AI without scaling headcount. Book a Maia demo today. accelerate aidata pipelinesroadmapautomatedmaia https://hiber.global/ Remote IoT Monitoring for Oil, Gas, and Pipelines- Hiber.Global Apr 23, 2026 - Explore HiberHilo’s remote IoT monitoring for pipelines, offering real-time data, cost savings, and sustainable solutions globally. iot monitoringoil gasremotepipelinesglobal https://tidydatatutor.com/ Tidy Data Tutor - visualize R tidyverse data pipelines tidy data tutorvisualizetidyversepipelines https://seqera.io/pipelines/ Pipelines | Seqera Find the best Nextflow pipelines from the community and add them to Seqera Platform, or run locally. pipelines https://www.tensorflow.org/guide/data tf.data: Build TensorFlow input pipelines | TensorFlow Core tfdatabuildtensorflowinput https://nickpoorman.com/2020-07-26-data-pipelines-part-2-retries/ Data Pipelines: Part 2 - Building A Cloud-Scale Central Retry Service For Data Pipelines | A blog... Aug 1, 2020 - Building a cloud-scale central retry service for Data Pipelines. building a cloud https://www.monad.com/ Security Data Pipelines for Enterprise Teams | Monad Monad normalizes, filters, enriches, and routes your security data before it hits your SIEM — cutting ingestion costs and freeing teams to focus on threats. security data pipelinesfor enterprise teamsmonad https://www.heat-trace.com/products/longline-heating-cables/longline-hts1f Longline (HTS1F) - 3-Phase Heating Cable for Long Pipelines | Heat Trace Longline (HTS1F) is a series resistance, single conductor heating cable . It can be supplied as three cables for configuring into a 3 phase heating system. heating cablelonglinephase https://britfeed.co.uk/how-ambitious-brits-are-building-sales-pipelines-on-a-budget/ How Ambitious Brits Are Building Sales Pipelines on a Budget - Brit Feed May 6, 2026 - There is something quietly revolutionary happening across Britain right now. In spare bedrooms, at kitchen tables, during lunch breaks and late evenings, on a budgetbuilding sales https://www.jiutaiendoscope.com/tag/pipe-crawler-camera-ensure-safe-operation-of-heating-pipelines/ Pipe Crawler Camera Ensure Safe Operation Of Heating Pipelines Archives - JIU TAI TECHNOLOGY https://www.gs-pipeline.com/tag/oil-and-gas-pipelines/ oil and gas pipelines - Shaanxi Gold-stone oil and gas pipelinesshaanxigoldstone https://www.kozminski.edu.pl/pl/4innopipe2-strengthening-innovation-pipelines-impactful-universities-20 4InnoPipe2: Strengthening Innovation Pipelines for Impactful Universities 2.0 | Akademia Leona... strengtheninginnovationpipelines https://synapse.patsnap.com/organization/b285e0774b198bf60ec431f4bfb380f3 Eliva IVF AB - Drug pipelines, Patents, Clinical trials - Synapse Explore Eliva IVF AB with its drug pipeline, therapeutic area, technology platform, . clinical trialsivfabdrugpipelines https://docs.hazelcast.com/hazelcast/5.4/pipelines/building-pipelines About Stream Processing Pipelines | Hazelcast Documentation Streaming jobs are those that process an infinite amount of data such as a continuous event stream. Because these jobs continue to run until they are canceled,... stream processingpipelineshazelcastdocumentation https://synapse.patsnap.com/organization/b2eeb3bdd03c51f123ab46fe3b963017 Hanzhong High Tech Pharmaceutical Chemical Co., Ltd. - Drug pipelines, Patents, Clinical trials -... Explore Hanzhong High Tech Pharmaceutical Chemical Co., Ltd. with its drug pipeline, therapeutic area, technology platform, . high techpharmaceutical chemical https://www.psi.de/loesungen/branchen/gasnetze-und-pipelines Gasnetze und Pipelines undpipelines https://synapse.patsnap.com/organization/b34389d7c15d600b291e5e45a2471c95 Zhangzhou Yuen Biotechnology Co., Ltd. - Drug pipelines, Patents, Clinical trials - Synapse Explore Zhangzhou Yuen Biotechnology Co., Ltd. with its drug pipeline, therapeutic area, technology platform, . clinical trialszhangzhoubiotechnologycoltd https://synapse.patsnap.com/organization/67c09a90ae85f2c67306883c4df1b0a1 NaniRx Therapeutics, Inc. - Drug pipelines, Patents, Clinical trials - Synapse Explore NaniRx Therapeutics, Inc. with its drug pipeline, therapeutic area, technology platform, , Drug:PINS. clinical trialstherapeuticsincdrugpipelines https://azure.microsoft.com/en-in/products/devops/pipelines Azure Pipelines | Microsoft Azure Get 10 free parallel jobs for cloud-based CI/CD pipelines for Linux, macOS, and Windows. Automate builds and easily deploy to any cloud with Azure Pipelines. azure pipelinesmicrosoft https://synapse.patsnap.com/organization/b336db6b37fed65baa16d2f02995fc74 Torrington Medical Group, Inc. - Drug pipelines, Patents, Clinical trials - Synapse Explore Torrington Medical Group, Inc. with its drug pipeline, therapeutic area, technology platform, . medical groupclinical trialstorringtonincdrug https://www.africasurveyorsonline.com/nextbillion-ai-partners-with-google-cloud-to-deploy-data-pipelines/ NextBillion AI Partners with Google Cloud To Deploy Data Pipelines - Africa Surveyors Jan 15, 2025 - NextBillion AI, an industry-leading startup in mapping platforms that provides software-as-a-service (SaaS) for enterprises, partners ai partnerswith google https://www.alliancebernstein.com/nz/en/institutions/insights/investment-insights/healthcare-pipelines-and-paychecks-a-formula-for-assessing-executive-pay.html Healthcare Pipelines and Paychecks: A Formula for Assessing Executive Pay | AB Apr 15, 2026 - Our research suggests that firms with sound executive pay practices yield healthier returns. executive payhealthcarepipelinespaychecks https://synapse.patsnap.com/organization/d8af97df37070913790aedc0d2fe60c6 Danisco Holdings (UK) Ltd. - Drug pipelines, Patents, Clinical trials - Synapse Explore Danisco Holdings (UK) Ltd. with its drug pipeline, therapeutic area, technology platform, , Drug:ED-002, Cordycepin. clinical trialsdaniscoholdingsukltd https://qureshi.me/modernizing-terraform-pipelines-on-azure-oidc-federation-for-github-actions-and-azure-devops/ Modernizing Terraform Pipelines on Azure: OIDC Federation for GitHub Actions and Azure DevOps -... May 3, 2026 - Many Terraform-on-Azure pipelines still use the same authentication methods they adopted three years ago. This often involves relying on a long-lived on azure https://sl-advisors.com/the-election-and-pipelines The Election and Pipelines - SL-Advisors the electionpipelinessladvisors https://developersdigest.tech/tags/pipelines Developers Digest on pipelines - Developers Digest 1 items tagged pipelines - blog posts, tools, guides, and tutorials on Developers Digest. developersdigestpipelines https://tchtrends.net/understanding-snowflake-triggers-and-their-impact-on-etl-pipelines/ Understanding Snowflake Triggers and Their Impact on ETL Pipelines - tchtrends Mar 13, 2025 - ETL (Extract, Transform, Load) pipelines are crucial for modern data management, ensuring seamless data integration, transformation, and storage. Many... impact onetl pipelinesunderstandingsnowflaketriggers https://digitalitnews.com/tag/observability-pipelines/ Observability Pipelines Archives | Digital IT News observability pipelinesarchivesdigitalnews https://www.worldpipelines.com/business-news/26092014/tallgrass-announces-potential-expansion-of-oil-pipeline-system/ Tallgrass announces potential expansion of oil pipeline system | World Pipelines Sep 26, 2014 - Tallgrass Pony Express Pipeline announces potential expansion of crude oil pipeline system. oil pipelinetallgrassannouncespotentialexpansion https://synapse.patsnap.com/organization/b34fca0be6a7783b0d49fa578034c207 Hainan Geding Biotechnology Co., Ltd. - Drug pipelines, Patents, Clinical trials - Synapse Explore Hainan Geding Biotechnology Co., Ltd. with its drug pipeline, therapeutic area, technology platform, . clinical trialshainanbiotechnologycoltd https://www.jee.co.uk/lifetime-extension-of-rigid-pipelines-and-flexibles Lifetime Extension of Rigid Pipelines and Flexibles Learn how to extend the lifetime of rigid pipelines and flexibles with our comprehensive course. lifetime extensionrigidpipelinesflexibles https://synapse.patsnap.com/organization/67b7da45a9b9d7a82b5871378564f4ca R Sterling Hodgson, Md LLC - Drug pipelines, Patents, Clinical trials - Synapse Explore R Sterling Hodgson, Md LLC with its drug pipeline, therapeutic area, technology platform, . clinical trialssterlinghodgsonmdllc https://www.worldpipelines.com/business-news/25072014/element-opens-new-oil-and-gas-materials-technology-centre-in-houston/ Element opens new oil and gas materials technology centre in Houston | World Pipelines Jul 25, 2014 - Element Materials Technology has opened a new flagship oil and gas materials technology centre in Houston, Texas. oil and gas https://pinelandsalliance.org/pinelands-not-pipelines-2/ pinelands-not-pipelines - Pinelands Alliance - Protecting the New Jersey Pinelands and Pine Barrens the newpipelinesallianceprotecting https://synapse.patsnap.com/organization/b38b8fe4dcb40d2af2d21f882a6b35c7 AQUAESTETICA CONSULTANTS SL - Drug pipelines, Patents, Clinical trials - Synapse Explore AQUAESTETICA CONSULTANTS SL with its drug pipeline, therapeutic area, technology platform, . clinical trialsconsultantssldrugpipelines https://synapse.patsnap.com/organization/b33e125e063b05b42aaaa28bc31eaf88 Shaanxi Fullway Bio-technology Co., Ltd. - Drug pipelines, Patents, Clinical trials - Synapse Explore Shaanxi Fullway Bio-technology Co., Ltd. with its drug pipeline, therapeutic area, technology platform, . bio technology https://synapse.patsnap.com/organization/67a64d7524cf6444e1e95c863c135a4d Clinquest, Inc. - Drug pipelines, Patents, Clinical trials - Synapse Explore Clinquest, Inc. with its drug pipeline, therapeutic area, technology platform, 1 clinical trial, 3 news, Drug:F-991, CQ-07001. clinical trialsincdrugpipelinespatents https://thedreamers.us/ai/scientific-ai/genomics/ Genomics & Bioinformatics Pipelines Genomics teams are usually drowning in data long before they are drowning in insight. Sequence data is large, heterogeneous, noisy, and expensive to move... genomicsbioinformaticspipelines https://launchdarkly.com/docs/integrations/bitbucket-pipelines Bitbucket Pipelines | LaunchDarkly | Documentation This topic explains how to create and enable feature flags using Bitbucket Pipelines, a continuous delivery platform that lets your team build, test, and... bitbucket pipelineslaunchdarklydocumentation https://xkcd.com/1649/ xkcd: Pipelines xkcdpipelines https://synapse.patsnap.com/organization/b36a508e0453b81ecd7d9cd8abb2a153 Centro Colaborador En Situaciones De Dependencia SL - Drug pipelines, Patents, Clinical trials -... Explore Centro Colaborador En Situaciones De Dependencia SL with its drug pipeline, therapeutic area, technology platform, . centro colaborador https://synapse.patsnap.com/organization/b327a5983ff917a6d63d52af11e7fdf7 Henan Bitong Medical Technology Co., Ltd. - Drug pipelines, Patents, Clinical trials - Synapse Explore Henan Bitong Medical Technology Co., Ltd. with its drug pipeline, therapeutic area, technology platform, . medical technology https://synapse.patsnap.com/organization/6750e139e965808ff563f10b7b5f476b Fayete Podiatry Associates Inc - Drug pipelines, Patents, Clinical trials - Synapse Explore Fayete Podiatry Associates Inc with its drug pipeline, therapeutic area, technology platform, . podiatry associatesclinical trialsincdrugpipelines https://wiki-tonic.win/index.php/From_Patios_to_Pipelines:_Mobile_Sandblasting_for_Residential,_Commercial,_and_Industrial_Surface_Preparation From Patios to Pipelines: Mobile Sandblasting for Residential, Commercial, and Industrial Surface... commercial and industrialmobile sandblasting https://geckodriver.com/automating-geckodriver-updates-in-ci-pipelines/ Automating GeckoDriver Updates in CI Pipelines Jan 15, 2026 - Learn how to automate GeckoDriver updates in CI pipelines to avoid version issues and keep your tests running smoothly. automatingupdatescipipelines https://vanmokld.com/real-time-leak-detection-matters-for-pipelines/ Why Real-Time Leak Detection Matters for Pipelines Oct 16, 2024 - Learn why real-time leak detection is crucial for pipeline safety, supported by advanced CPM and RTTM technologies in 2024. real timeleak detectionmatterspipelines https://buildkite.com/resources/plugins/ Buildkite Plugins | Extend your pipelines | Buildkite Extend the Buildkite platform with supported plugins for popular tools like Docker, ECR, Kubernetes, and more—or write your own. buildkitepluginsextendpipelines https://synapse.patsnap.com/organization/36828da19a7dd82e92ad6184485a671b Binhui Biopharmaceutical Co., Ltd. - Drug pipelines, Patents, Clinical trials - Synapse Explore Binhui Biopharmaceutical Co., Ltd. with its drug pipeline, therapeutic area, technology platform, 16 clinical trials, 5 news, and 9 literature, Disease... clinical trialsbiopharmaceuticalcoltddrug https://dronebundle.com/releases/custom-status-pipelines Custom Status Pipelines: Build Project and Job Workflows Your Way | DroneBundle Releases |... Apr 23, 2026 - Define ordered status pipelines for projects and jobs at the workspace level. Pick stages, colors, and categories that match how your team runs. Every record... https://wiro.ai/models?categories=3d-generation 3d-generation – AI Tools, APIs, Models, LLMs, Pipelines & Functions - Wiro AI Discover 3d-generation AI Tools, AI models, functions, and pipelines. Easily integrate AI into your apps, SaaS, or products. Ideal for developers and startups. ai toolsgeneration https://synapse.patsnap.com/organization/6782f45056780fe14bfa630a1865e6bf Shandong Kangyiweibao Biotechnology Co., Ltd. - Drug pipelines, Patents, Clinical trials - Synapse Explore Shandong Kangyiweibao Biotechnology Co., Ltd. with its drug pipeline, therapeutic area, technology platform, . clinical trialsshandongbiotechnologycoltd https://www.ohiogasassoc.org/2019/01/29/america-needs-more-oil-and-natural-gas-pipelines/ America Needs More Oil And Natural Gas Pipelines - Ohio Gas Association Dec 17, 2025 - Despite a 140% boom in U.S. crude oil production and a 50% jump in natural gas output since shale took flight in 2008, the midstream infrastructure to pipe... oil and natural gasamericaneedspipelinesohio https://synapse.patsnap.com/organization/678ed6fe62294796b8c11321416c9837 Dean, Horwitz & Associates - Drug pipelines, Patents, Clinical trials - Synapse clinical trialsdeanhorwitzassociatesdrug https://dev.azure.com/janklab/MatlabProjectTemplate/_build/results?buildId=219 Pipelines pipelines https://startupgrowthguide.com/how-to-secure-ci-cd-pipelines-against-supply-chain-attacks/ How to Secure CI/CD Pipelines Against Supply Chain Attacks - StartUp Growth Guide Sep 8, 2024 - CI/CD pipelines are becoming more central to the development process, making them top targets for supply chain attacks. supply chain attacks https://repository.ju.edu.et/handle/123456789/8217?show=full Corrosion Characterization at Surface and Subsurface of Iron-Based Buried Water Pipelines https://coldbox.ortusbooks.com/digging-deeper/promises-async-programming/async-pipelines-and-futures Async Pipelines & Futures | ColdBox HMVC Documentation To The Future with ColdBox Futures asyncpipelinesfuturescoldboxhmvc https://www.nextbigfuture.com/2026/05/other-pipelines-and-projects-to-bypass-oil-from-hormuz.html Other Pipelines and Projects to Bypass Oil From Hormuz | NextBigFuture.com May 5, 2026 - There are three pipelines operating now to take oil around the Hormuz blockage. other pipelinesand projects https://help.keycrm.app/en/communications-sms-email-instagram-telegram-viber-marketplace-chats-telephony/examples-of-communications-templates-for-pipelines Examples of communications templates for pipelines Ready-made examples of communications templates with variables that you can use to send in pipelines examplescommunicationstemplatespipelines https://eajournals.org/ijepr/vol-3issue3-august-2015/a-study-on-the-impact-of-microbes-on-oil-transporting-pipelines-in-obiafunobrikom-rivers-state-niger-delta-region-nigeria/ A Study On The Impact Of Microbes On Oil Transporting Pipelines In Obiafun/Obrikom, Rivers State,... Feb 28, 2023 - A study on the impact of microbes on oil transporting pipelines in Obiafun/Obrikom, Rivers State, Nigeria was conducted between 2011 and 2012. To harvest... https://www.pumpandslurry.com/ Home: Dredging & Pumping Equipment, Slurry Pipelines and Consulting - Slurry Pumping and Dredge... pumping equipmentdredgingslurrypipelinesconsulting https://techktimes.co.uk/from-pipelines-to-prompts-why-data-engineering-is-the-hidden-hero-of-generative-ai/ From Pipelines to Prompts: Why Data Engineering is the Hidden Hero of Generative AI - Tech k Times Nov 1, 2025 - Generative AI has quickly become one of the most talked-about technologies of our time. From chatbots that write convincing essays to image generators that... https://kb.databricks.com/en_US/delta-live-tables/lakeflow-declarative-pipelines-failing-with-the-error-untraceable_table_modification Lakeflow Declarative Pipelines failing with the error "UNTRACEABLE_TABLE_MODIFICATION" - Databricks declarativepipelinesfailing https://synapse.patsnap.com/organization/b2dec12d5c5c2e96ac1d5c7915b4a559 Nynj Psychiatric Associates LLC - Drug pipelines, Patents, Clinical trials - Synapse Explore Nynj Psychiatric Associates LLC with its drug pipeline, therapeutic area, technology platform, . psychiatric associatesclinical trialsllcdrugpipelines https://www.rangerpipelines.com/tag/sewer-transmission/ Sewer Transmission Archives - Ranger Pipelines sewertransmissionarchivesrangerpipelines https://synapse.patsnap.com/organization/b2da31e8864af8fbedad10c61abffaac Ir Vision - Drug pipelines, Patents, Clinical trials - Synapse Explore Ir Vision with its drug pipeline, therapeutic area, technology platform, . clinical trialsirvisiondrugpipelines https://openobserve.ai/pipelines/ OpenObserve Pipelines | Real-Time Data Processing & Enrichment Transform observability data with real-time and scheduled pipelines. VRL functions, enrichment tables, and custom data processing. Flexible stream operations... real time dataopenobservepipelinesprocessingenrichment https://datavolo.io/ Multimodal Data Pipelines for AI | Datavolo | Home Nov 19, 2024 - Datavolo helps engineers like you build better multimodal data pipelines for generative AI. Capture all of your unstructured data. multimodal datafor aipipelines https://synapse.patsnap.com/organization/b2dd84aac9bb9858b5739081d701404a J David Karlin, M D A PC - Drug pipelines, Patents, Clinical trials - Synapse Explore J David Karlin, M D A PC with its drug pipeline, therapeutic area, technology platform, . https://azure.microsoft.com/en-us/products/devops/pipelines/ Azure Pipelines | Microsoft Azure Get 10 free parallel jobs for cloud-based CI/CD pipelines for Linux, macOS, and Windows. Automate builds and easily deploy to any cloud with Azure Pipelines. azure pipelinesmicrosoft https://santechnikos-centras.lt/en/15-internal-pipelines-and-connections Internal pipelines and connections Internal pipelines and connections buy online at a great price and fast delivery. A wide selection of plumbing products in one place at a lower price. internalpipelinesconnections https://dr.ddn.upes.ac.in/items/f79e6677-c7cd-4fd6-8c2d-959683299a32 Detailed Engineering Analysis In Trunk Pipelines detailed engineeringanalysistrunkpipelines https://timera-energy.com/capability-tags/storage-pipelines/ Storage & pipelines - Timera Energy storagepipelinesenergy https://www.imec.org/building-apprenticeship-programs-a-practical-path-to-stronger-talent-pipelines/ Building Apprenticeship Programs: A Practical Path to Stronger Talent Pipelines - IMEC Site A practical guide for manufacturers to build apprenticeship programs that strengthen talent pipelines, improve retention, and deliver measurable ROI. apprenticeship programspractical path https://www.satelytics.com/resources/2021-the-academy-awards-for-pipelines The Academy Awards for Pipelines the academy awardspipelines https://synapse.patsnap.com/organization/b2eac213c86595c45b7a441ce3b98782 ColoRight Ltd. - Drug pipelines, Patents, Clinical trials - Synapse Explore ColoRight Ltd. with its drug pipeline, therapeutic area, technology platform, . clinical trialsltddrugpipelinespatents https://nf-co.re/docs/developing/tutorials/writing-nf-core-modules/8-using Docs: Chapter 8: Using nf-core modules in pipelines How to use nf-core modules in a pipeline core modulesdocschapterusingnf https://blog.geogarage.com/2024/08/tno-develops-detection-system-to.html GeoGarage blog: TNO develops detection system to protect cables and pipelines on seabed Dark fibers can help to protect cables and pipelines. Image TNO From Defense Industry TNO has developed a method to automatically detec... https://www.crudeoildaily.com/2025/04/healey-new-natural-gas-pipelines-not.html Crude Oil Daily: Healey: New natural gas pipelines not needed natural gas pipelinescrude oildailyhealeynew https://www.readystart.eu/rubrieken/pipelines/ Pipelines Vind de beste links en artikelen op de Readystart.eu Startpagina pipelines https://bdaily.co.uk/articles/2021/05/18/steven-mcgill-joins-eap-as-head-of-pipelines Steven McGill joins EAP as Head of Pipelines | Bdaily Bdaily UK | Business News stevenmcgilljoinseaphead https://mbot.com/membership/member-directory/enbridge-pipelines-inc/ Enbridge Pipelines Inc. - Mississauga Board of Trade board ofenbridgepipelinesincmississauga https://www.centerpointenergy.com/en-us/Corp/Pages/interstate-pipelines-and-field-services.aspx?sa=OT&au=bus Interstate Pipelines and Field Services interstatepipelinesfieldservices https://www.legislation.wa.gov.au/legislation/statutes.nsf/law_s4688.html&view=reprint WALW - Petroleum Pipelines Regulations 1970 - Home Page petroleumpipelinesregulations https://aws.amazon.com/marketplace/reviews/reviews-list/prodview-5xxl5nyidqwxq AWS Marketplace: Edge Delta Pipelines Reviews aws marketplaceedgedeltapipelinesreviews https://synapse.patsnap.com/organization/b2fd2cb2adf4f992954975902819604c Scott Griffith M D P C - Drug pipelines, Patents, Clinical trials - Synapse Explore Scott Griffith M D P C with its drug pipeline, therapeutic area, technology platform, . m dp c https://docs.databricks.com/aws/en/ldp/configure-compute Configure classic compute for pipelines | Databricks on AWS Learn how to configure classic compute resources for your Lakeflow Spark Declarative Pipelines. configureclassiccomputepipelinesdatabricks https://zenodo.org/records/20075197 github.com/DataBiosphere/terra-scientific-pipelines-service/ReshapeReferencePanel May 7, 2026 - Terra Scientific Pipelines Service Overview Terra Scientific Pipelines Service, or Teaspoons, facilitates running a number of defined scientific pipelines on... githubterrascientificpipelinesservice https://tech.marksblogg.com/alberta-pipelines.html Alberta's Pipelines albertapipelines https://eudoxuspress.com/index.php/pub/article/view/3336/2388 View of Designing Scalable ETL Pipelines for Multi-Source Graph Database Ingestion etl pipelines https://synapse.patsnap.com/organization/b349045bc2963c64d62c41b51fc593f4 Lawrence S Lee M D - Drug pipelines, Patents, Clinical trials - Synapse Explore Lawrence S Lee M D with its drug pipeline, therapeutic area, technology platform, . lee mclinical trialslawrence https://synapse.patsnap.com/organization/b2b861af3ac7946174a5402547896c6e Sichuan Furun Biotechnology Co., Ltd. - Drug pipelines, Patents, Clinical trials - Synapse Explore Sichuan Furun Biotechnology Co., Ltd. with its drug pipeline, therapeutic area, technology platform, . clinical trialssichuanbiotechnologycoltd https://synapse.patsnap.com/organization/67bb861b574aba42d03e32553155622d Neihuangda Fusheng Biotechnology Co., Ltd. - Drug pipelines, Patents, Clinical trials - Synapse Explore Neihuangda Fusheng Biotechnology Co., Ltd. with its drug pipeline, therapeutic area, technology platform, . clinical trialsfushengbiotechnologycoltd https://www.genomerevelations.com/post/bioinformatics-pipelines Bioinformatics pipelines May 30, 2024 - Bioinformatics pipelines are essential for processing and analyzing large-scale biological data. They streamline complex workflows by automating a series of... bioinformaticspipelines https://synapse.patsnap.com/organization/b2cd3a1139ebe488c727930d2bf9f38b Lars Martin Borge AS - Drug pipelines, Patents, Clinical trials - Synapse Explore Lars Martin Borge AS with its drug pipeline, therapeutic area, technology platform, . clinical trialslarsmartindrugpipelines