https://moldassessmentauthority.com/
Mold Assessment Authority | Mold Assessment
The Restoration Services Provider Network on moldassessmentauthority.com compiles verified listings of licensed mold ass
mold assessmentauthority
https://enneagramassessmenttest.org/
Free Enneagram Assessment Test | Discover Your Enneagram Type
Take our free Enneagram test to discover your Enneagram type (Type 1 through Type 9). Understand your personality, motivations, and growth opportunities.
free enneagram assessmenttestdiscovertype
https://enneagramassessment.org/
Free Enneagram Assessment Test | Discover Your Enneagram Type
Take our free Enneagram Assessment test to discover your personality type (Type 1 through 9).
free enneagram assessmenttestdiscovertype
https://royalwin1.in/
Royal Win Review 2026: Legit Platform or Fake? Honest Assessment for Indian Players
Independent Royal Win review with real user complaints, legal status in India, bonus conditions analysis, game categories, and a step-by-step safety checklist....
https://strengthsfinderassessment.org/
Free StrengthsFinder Assessment | Find Your Top 5 Strengths
Take our free StrengthsFinder assessment to discover your top 5 talent themes across Executing, Influencing, Relationship Building, and Strategic Thinking....
free strengthsfinderassessmenttop
https://www.legionellariskassessmentregister.com/
Legionella Risk Assessments – The Legionella Risk Assessment Accreditation Body
legionella risk assessmentsaccreditationbody
https://www.bphenergyassessments.com/
BPH Energy Assessments Limited – United Kingdoms Largest Energy Assessment Company
energy assessmentsunited kingdomsbphlimitedlargest
https://learntae.com.au/
Certificate IV in Training and Assessment - Learn TAE
May 11, 2026 - Enrol in the TAE40122 Certificate IV in Training and Assessment today. Flexible delivery, expert support - start your VET career with Learn TAE now!
training and assessmentcertificate ivlearntae
https://intelligentietesten.com/
Intelligentietesten.com - Cognitive Assessment Domain
Intelligentietesten.com offers a unique web presence for cognitive assessment and intelligence testing services.
cognitive assessmentdomain
https://newsela.com/
Newsela | Content and assessment platform
newselacontentassessmentplatform
https://a2la.org/
Assessment Accreditation Services | A2LA
Apr 21, 2026 - A2LA empowers calibration and testing laboratories, organizations, and individuals to participate in accreditation. Explore laboratory accreditation services.
accreditation servicesassessment
https://www.texasassessment.gov/
Texas Assessment
texasassessment
https://assessmyteam.com/
Online Assessment Tools and Tests for Safety Teams- Assess My Team
Jun 22, 2022 - Assessments for Your Team “You can’t manage what you can’t measure.”~ Peter Drucker Learn More EFFECTIVE LEADERSHIP REQUIRES UNDERSTANDING EACH INDIVIDUAL ON...
online assessment toolsfor safety teamstests
https://londonrehab.ca/
London Rehab – Professional and Clinical Assessment Services
clinical assessmentlondonrehabprofessionalservices
https://caqacourses.com.au/
VET Training Resources | Assessment Materials for RTOs Australia | CAQA Courses
CAQA Courses is Australia's top provider of RTO Training Resources, VET learning, and assessment materials from the BSB, ICT, NUR, HLT, FNS, CHC, etc. Training...
training resourcesfor rtosvetassessmentmaterials
https://xite.ai/
Generative AI - Use Cases | Assessment | Labs | Services
Jun 12, 2026 - XITE Create offers Generative AI services that will future-proof businesses. Our expert team will provide strategic GenAI solutions with clear ROIs.
ai use casesgenerativeassessmentlabsservices
https://gifts.churchgrowth.org/spiritual-gifts-survey/
Spiritual Gifts | FREE Spiritual Gifts Survey | Assessment, Analysis, Test
Dec 21, 2023 - Identify your God-given spiritual gifts with the FREE spiritual gifts assessment and spiritual gifts test from Team Ministry and ChurchGrowth.org.
spiritual giftsfree surveyassessment analysistest
https://freeenneagramassessment.org/
Free Enneagram Assessment Test | Discover Your Personality Type | FreeEnneagramAssessment.org
Free online Enneagram personality assessment. Discover your Enneagram type based on your personality traits, motivations, and behaviors. Get personalized...
free enneagram assessmentyour personalitytestdiscovertype
https://freestrengthsfinder.org/
Free CliftonStrengths Assessment | Free StrengthsFinder Test | FreeStrengthsFinder.org
Take our free CliftonStrengths assessment to discover your top talent themes. Based on Gallup's research, identify your natural talents and maximize your...
cliftonstrengths assessmentstrengthsfinder testfree
https://www.dimva.org/dimva2026/
23rd Conference on Detection of Intrusions and Malware & Vulnerability Assessment (DIMVA '26)
https://strengthsfinderassessment.com/
Free StrengthsFinder Assessment | Discover Your Top Talents | StrengthsFinderAssessment.com
Free online StrengthsFinder assessment. Discover your top talents and strengths based on the CliftonStrengths methodology. Get personalized strength...
free strengthsfindertop talentsassessmentdiscover
https://www.nwea.org/
Leader in K-12 Assessment and Research | NWEA
Jul 27, 2026 - Advancing learning outcomes for all kids. We empower educators and learners with evidence-based products and services that unlock opportunity.
assessment and researchleaderknwea
https://careeraptitudeassessment.com/
Free Career Aptitude Assessment | Discover Your Ideal Career Path | CareerAptitudeAssessment.com
Free online career aptitude assessment. Discover your ideal career path based on your skills, interests, and personality. Get personalized career...
career aptitude assessmentfreediscoveridealpath
https://egfr-calculator.com/
eGFR Calculator Online - Professional Kidney Function Assessment Tool
egfr calculatorkidney functiononlineprofessionalassessment
https://www.christianpersonalitytest.com/
Christian DISC® Assessment Official Site | Christian Personality Test
Trusted by churches, teams, and professionals, this Christian personality test blends biblical insight with the proven DISC model to strengthen spiritual...
official sitechristianassessmentpersonalitytest
https://www.profilesgac.com/Login.aspx
Global Assessment Center
global assessmentcenter
https://discassessment.org/
Free DISC Personality Assessment | Discover Your Personality Type | DISCAssessment.org
Take our free DISC personality test to discover your personality type (Dominance, Influence, Steadiness, Conscientiousness). Understand your work style and...
disc personality assessmentdiscover your typefree
https://cyberinsurancecalc.com/
Cyber Insurance Calculator | Risk Assessment Tool 2026
Cyber insurance calculator that evaluates your security posture across 11 domains and provides personalized coverage recommendations. Free with CISO...
risk assessment toolcyber insurancecalculator
https://bkbo.nl/producten/digid-assessment/
DigiD assessment door een specialist | BKBO B.V.
Feb 9, 2026 - Voor een DigiD assessment schakelt u een specialist in. Wij zijn uw specialist op het gebied van audits. Neem vandaag nog contact met ons op!
digid assessmentdooreenspecialistb
https://assessment-vergelijken.nl/
Assessment Vergelijken
Dec 26, 2025 - Vergelijk assessment aanbieders en kies de beste assessments. Selecteer uit assessment organisaties in Nederland. Selecteer kwaliteit.
assessmentvergelijken
https://www.cambridgeassessment.org.uk/
Cambridge Assessment Network and Research
Research is at the heart of all our qualifications and programmes. Cambridge Assessment Network provides professional development to the assessment community.
cambridge assessmentnetworkresearch
https://www.centreforassessment.co.uk/
Home | Centre for Assessment
Centre for Assessment is a leading provider of accreditation and certification services to businesses and organisations across the UK.
home centreassessment
https://app.edulastic.com/login
Pear Assessment: Formative and Summative Assessments Made Easy
pear assessmentsummative assessmentsformativemadeeasy
https://www.forewarn.com/
Risk Assessment & Due Diligence App For Professionals | FOREWARN
Jun 17, 2026 - FOREWARN is a proactive safety and intelligence app that provides instant knowledge prior to face-to-face engagements to better understand and address risk.
risk assessmentdue diligenceapp forprofessionalsforewarn
https://www.liveseysolar.com/
Unlocking Practice Revenue: Take Our Free Assessment
Jul 7, 2026 - Discover the bottlenecks blocking your eye surgery practice's growth potential. Take our FREE Practice Marketing Assessment today.
unlockingpracticerevenuetakefree
https://www.darkfoxthreat.com/
Violence Risk Assessment | DarkFox from D-prep
DarkFox is an online Violence Risk Assessment tool that collects and organizes data related to a potential violence risk. The information shared is used to...
violence risk assessmentdarkfoxprep
https://telehealthtechnology.org/
TTAC – National Telehealth Technology Assessment Resource Center
national telehealthtechnology assessmentttacresourcecenter
https://biometric.myprivacy.blog/
Biometric Identifiers Risk Tracker 2026 | Privacy Risk Assessment
May 5, 2026 - Biometric Identifiers Risk Tracker 2026 — Monitor 124 biometric surveillance technologies including facial recognition, DNA verification, AI voice cloning,...
biometricidentifiersrisktrackerprivacy
https://icueducation.com/
ICU education - Self Assessment and Online Training Portal dedicated to Critical Care Medicines
Self Assessment and Online Training Portal dedicated to Critical Care Medicines.
online training portal
https://edulabs.co.in/
EduLabs Learning Solutions - Modern Online Assessment
EduLabs Learning Solutions - Modernize your online assessment with advanced psychometrics, security, and 60+ item types.
learning solutionsmodern onlineedulabsassessment
https://www.different-class.com/
Different Class | Data Consultation | Software Development | Website Design | Assessment, Software...
different classdata consultationsoftware developmentwebsite designassessment
https://allinaccess.com.au/
SDA Consulting | SDA Assessment & Funding | North Queensland
sdaconsultingassessmentfundingnorth
https://www.vtest.com/
VTest: Secure Online Testing & Assessment Platform
Nov 19, 2025 - Take advantage of our quality English assessment tools and secure online testing platform to effortlessly create and administer exams for your needs.
secure online testingvtestassessmentplatform
https://oxedandassessment.com/
OxEd | Evidence-based oral language solutions | OxEd & Assessment
May 19, 2026 - Assessment, whole class instruction and targeted intervention to assess, diagnose and support children's early language and behaviour.
evidence basedoral languagesolutionsassessment
https://jefferson.co1.qualtrics.com/jfe/form/SV_aWXtn1oj2WGUaMu
ALT Inclusive Teaching Strategies Self Assessment
The most powerful, simple and trusted way to gather experience data. Start your journey to experience management and try a free account today.
inclusive teachingaltstrategiesselfassessment
https://fenziteamtitles.com/
TEAM Titles | Training Excellence Assessment Modules
training excellenceteamtitlesassessmentmodules
https://www.btaminstitute.com/
BTAM Institute | Behavioral Threat Assessment and Management
The BTAM Institute offers a unique, hands-on two-day certification training that takes threat assessment beyond theory and into practice. Designed for BIT/CARE...
behavioral threat assessmentinstitutemanagement
https://vfsa.org.vn/
Vietnam Center for Food Safety Risk Assessment (VFSA)
Đánh giá nguy cơ là một mắt xích quan trọng trong đảm bảo an toàn vệ sinh thực phẩm!
center for food safetyrisk assessmentvietnam
https://ssaephysicalsecurity.com/
SSAE 18 Physical Security Assessment Tool | SOC 2 Compliance 2026
SSAE 18 physical security assessment tool aligned to 2026 AICPA Trust Services Criteria. Evaluate 7 domains, generate remediation plans, and export...
physical security assessmenttoolsoccompliance
https://secure.njappealonline.com/prodappeals/login.aspx
NJ Online Assessment Appeals
nj onlineassessmentappeals
https://www.cde.ca.gov/ta/tg/ca/
California Assessment of Student Performance and Progress (CAASPP) System - Testing (CA Dept of...
California's statewide student assessment system.
student performance
https://naturalhealthtest.com/
Welcome to the Nutrition, Lifestyle and Anti-aging Assessment
Free Powerful Online Health Assessment. Instant downloadable results, Comprehensive personalized report, diet and lifestyle recommendations
welcome to theanti agingnutritionlifestyleassessment
https://pctam.net/
Putnam County Threat Assessment Management – Putnam County, NY
putnam countythreat assessmentmanagementny
https://ransomwarematurity.com/
Ransomware Readiness Assessment Tool 2026 | RansomwareMaturity.com
Free ransomware maturity assessment for organizations. Score your prevention, detection, response, recovery, and governance controls against NIST CSF 2.0....
ransomware readinessassessment tool
https://scofasleepcare.com/screening-sleep-test/
Screening Sleep Test: At-Home Apnea Assessment | Scofa Sleepcare
Feb 26, 2026 - Take our convenient screening sleep test at home. A simple first step to check for sleep apnea and start your journey to better rest.
sleep test at homescreeningapneaassessmentscofa
https://www.lifeway.com/en/articles/women-leadership-spiritual-gifts-growth-service
Spiritual Gifts Assessment Tool: Discover Your God-Given Spiritual Gifts | Lifeway
Use these Spiritual Assessment Tools to help you to understand where you are spiritually and how God has gifted you. As a church leader you can empower the...
spiritual gifts assessmentyour godtooldiscovergiven
https://assessment.cot.tn.gov/TPAD
Tennessee Property Assessment Data | Home
This site allows anyone to search for property values and other key information about properties across the state of Tennessee. The data on this site is...
property assessment datatennessee
https://nashreviewer.com/
National Assessment for School Heads (NASH) - NASH Reviewer
Comprehensive review platform for aspiring school heads preparing for NASH (formerly NQESH). Practice questions aligned with all 5 PPSSH domains and 34 strands...
for schoolnationalassessmentheadsnash
https://va-results.pearsonaccessnext.com/login
Virginia Assessment Parent Portal
virginiaassessmentparentportal
https://www.giuntipsy.it/
Giunti Psychometrics Italia | Testing e assessment psicologico
Giunti Psychometrics: l'eccellenza per l'assessment psicologico in ambito clinico e HR. Per te test psicodiagnostici, corsi di formazione e libri di psicologia.
giunti psychometricsitaliatestingassessmentpsicologico
https://cybercat.tools/
Home | CAT - Cybersecurity Assessment Tool
Free cybersecurity assessment tool for NGOs and civil society organizations. Evaluate your digital security and get actionable recommendations.
cybersecurity assessmentcattool
https://clear-minds.com.au/
Clear Minds | Expert ADHD Assessment in Australia
Clear Minds offers expert ADHD assessment and ongoing care to help you or your child thrive. Access professional, compassionate support, start your journey...
clear mindsadhd assessmentexpertaustralia
https://www.openlca.org/
openLCA.org | openLCA is a free, professional Life Cycle Assessment (LCA) and footprint software...
life cycle assessment
https://esgiama.com/
ESG.IAMA (ESG Identity Asset Manager Assessment) is the first quantitative standard able to measure...
https://www.pbl.nl/en
Home | PBL Netherlands Environmental Assessment Agency
environmental assessmentpblnetherlandsagency
https://dataprivacytool.info/
Privacy Compliance Assessment Tool | GDPR, CCPA, HIPAA Compliance Check
Privacy compliance assessment tool. Identify which regulations apply to your organization — GDPR, CCPA/CPRA, HIPAA, GLBA, and 18+ US state privacy laws.
privacy compliance assessmenttoolgdprccpahipaa
https://fireriskassessmentsurrey.co.uk/
ESI Fire Risk Assessment Surrey - Fire Safety Specialists
Mar 1, 2026 - Helping business and property owners across Surrey with specialist fire safety advice - fire risk assessment surrey, fire alarms, fire extinguishers
fire risk assessmentesisurreysafetyspecialists
https://ratemysoc.com/
Rate My SOC | SOC Maturity Assessment Tool 2026
SOC maturity assessment tool for CISOs and security teams (free with CISO Marketplace membership; or credits / one-time guest pass). Evaluate your Security...
soc maturity assessmentrate mytool
https://www.vetassess.com.au/
Australia’s largest skills assessment service | VETASSESS
VETASSESS is Australia's leading vocational education and training (VET) skills assessment provider for both migration and national skills recognition.
skills assessmentlargestservicevetassess
https://www.nnas.ca/
Start your nursing journey in Canada. - National Nursing Assessment Service
Jul 24, 2024 - Canadian Nursing Professions Canada has three nursing professions: RN, LPN and RPN. Education and experience in any of these roles can lead to a rewarding...
start yourjourney innursingcanadanational
https://www.symbis.com/
Pre-Marriage Assessment | SYMBIS.com
Jul 13, 2026 - The world's most practical pre-marriage assessment. Perfect for pre-engaged, engaged and newly married couples. The future of premarital assessments.
pre marriageassessmentsymbis
https://megateamhealth.com/
Market Mayor HealthScore Assessment
Take the free assessment to find your team's gaps and strengths
marketmayorassessment
https://netpeaksoftware.com/
SEO Tools for Site Checkup & Assessment – Netpeak Software
Join 150K users worldwide and leverage Netpeak’s SEO analysis software for daily SEO tasks. Get access to our products for free!
seo toolssitecheckupassessmentnetpeak
https://nacca.gov.gh/
National Council for Curriciulm & Assessment - Official Website
Apr 17, 2026 - The National Council for Curriculum and Assessment (NaCCA) of Ghana is an independent statutory body committed to improving learning experiences...
national councilassessmentofficial
https://www.asd-360.com/
Private Autism Assessment Clinic & Support | Autism 360
May 28, 2026 - Welcome To Autism 360, Your Private Autism Assessment Clinic. Supporting Patients Throughout The UK. We Are A Private Specialist Autism...
autism assessmentclinic supportprivate
https://www.semperis.com/purple-knight/
Active Directory Security Assessment | Purple Knight
May 19, 2026 - Purple Knight, built by Semperis, is the top Active Directory security assessment tool today. Identify threats and get prioritized guidance.
active directory securityassessmentpurpleknight
https://ukneqas.org.uk/
Home - UK NEQAS | External Quality Assessment Services
Mar 21, 2022 - UK NEQAS Home - Helping to ensure clinical laboratory test results are accurate, reliable and comparable wherever they are produced.
external quality assessmenthome ukservices
https://cbta.de/
CBTA - Competency Based Training and Assessment
Sep 10, 2025 - Das kompetenzbasierte Trainings- und Beurteilungsprogramm CBTA. CBTA-Tests und -Bewertungen online erstellen und durchführen
competency based trainingcbtaassessment
https://www.canada.ca/en/employment-social-development/services/foreign-workers.html
Hire a temporary foreign worker with a Labour Market Impact Assessment - Canada.ca
Learn about the requirements for hiring foreign workers through the Temporary Foreign Worker Program and what you need to apply for a Labour Market Impact...
temporary foreign worker
https://fash.homicidesupporthub.org/
The Hub - F.A.S.H | Family Assessment Support Homicide
the hubf aassessment supportfamilyhomicide
https://catalyit.com/tech-assessment
Agency Tech Assessment
Evaluate your agency's technology with Catalyit's Tech Assessment. Identify gaps, optimize efficiency, and get insights to enhance your tech strategy.
agencytechassessment
https://proqassessment.com/
ProQ™ — Progressive Intelligence Assessment
Measure how intelligently you adapt, sequence, and scale under complexity. The ProQ™ Assessment evaluates five core domains in 90–120 minutes.
progressiveintelligenceassessment
https://www.gov.uk/guidance/standard-assessment-procedure
Standard Assessment Procedure - GOV.UK
Overview of how a home's energy performance is calculated using the Standard Assessment Procedure (SAP).
assessment procedurestandarduk
https://www.archiuk.com/
ARCHI | Site Data | Archaeological Assessment | Land & Property Assessments | Human Environmental...
site dataland propertyarchiarchaeologicalassessment
https://koalainsulation.com/
Koala Insulation - Installation and Assessment Experts
Jul 2, 2026 - Koala Insulation offers expert insulation services to improve energy efficiency, comfort, and savings in your home or business. Get a free estimate today!
insulation installationkoalaassessmentexperts
https://taxpacks.co.uk/
TaxPacks | UK Tax Returns, Self Assessment & Accounting Services
TaxPacks provides professional UK tax return preparation, Self Assessment support, bookkeeping, accounting, VAT, payroll.
uk taxself assessmentreturnsaccountingservices
https://phishingrisk.com/
Phishing Risk Assessment Tool 2026 | Organizational Security Evaluation
Phishing risk assessment tool for 2026 — free with CISO Marketplace membership (or credits / one-time guest pass). Evaluate your organization's vulnerability...
risk assessment toolorganizational securityphishingevaluation
https://www.gallup.com/cliftonstrengths/en/home.aspx
CliftonStrengths Online Talent Assessment | EN - Gallup
Sep 21, 2019 - Learn how the CliftonStrengths assessment -- formerly StrengthsFinder -- empowers organizations, managers and millions of people to succeed.
talent assessmentcliftonstrengthsonlinegallup
https://harver.com/
Talent Assessment Platform for Faster, Better Hiring | Harver
Jul 30, 2026 - Harver helps enterprise teams hire better, faster with predictive assessments, automation, AI readiness tools, and data-driven talent insights.
talent assessmentbetter hiringplatformfasterharver
https://www.rapidai.com/
Clinical AI Platform Enhancing Assessment & Care | RapidAI
RapidAI delivers deep clinical AI on an enterprise platform, enhancing AI clinical assessment and transforming care across your service line programs.
clinical aiplatformenhancingassessmentcare
https://policytalk.org/
Institute for Objective Policy Assessment - School System Reform
institute forpolicy assessmentschool systemobjectivereform
https://freedepressiontest.org/
Free Depression Test | Depression Screening Assessment | FreeDepressionTest.org
Free online depression screening test. Assess your mental health with our clinically-validated questionnaire. Get immediate results and resources for support.
free depression testscreening assessment
https://socassessment.com/
SOC 2 Assessment Tool 2026 | SOC Compliance Management
Simplify SOC 2 compliance with our 2026-updated assessment tool. 180+ controls covering AI/ML governance, zero trust, SIEM, ransomware playbooks, and all AICPA...
assessment toolsoccompliancemanagement
https://thenarcissisttest.com/
Free Narcissist Test | NPI Assessment
Take our scientifically-validated narcissistic personality test based on NPI research. Discover narcissistic traits with our covert narcissist test. 100% Free...
narcissist testfreenpiassessment
https://oira.osha.europa.eu/en
Online interactive Risk Assessment |
OiRA is a web platform that enables the creation of sectoral risk assessment tools in any language in an easy and standardised way
online interactiveriskassessment
https://evaluationai.kreante.co/
Kreante - AI Assessment Hub
Interactive AI assessments and diagnostics by Kreante.
ai assessmentkreantehub
https://www.aim-group.org.uk/
Homepage | AIM Qualifications and Assessment Group
AIM Qualifications - Awarding Organisation, Access Validating Agency offering qualifications, Access to HE, Apprenticeship Assessment services.
homepageaimqualificationsassessmentgroup
https://www.skillspro-skillsassessment.com/
Skills Assessment Australia | Skillspro
Expertos en acreditación profesional en Australia. Recursos gratuitos, skills assessment y apoyo en tu proceso migratorio con SkillsPRO.
skills assessmentaustralia
https://solveyourmarketing.com/
Solve Your Marketing – Take our powerful free marketing assessment tool to discover where you need...
https://fenziteamobedience.com/
TEAM Titles Obedience | Obedience Training Excellence Assessment Modules
obedience trainingexcellence assessmentteamtitlesmodules