Robuta

https://magnaglobal.com/spotify-magna-study-finds-consumers-more-receptive-to-podcast-advertising-than-tv-advertisements/ SPOTIFY & MAGNA STUDY FINDS CONSUMERS MORE RECEPTIVE TO PODCAST ADVERTISING THAN TV ADVERTISEMENTS... Jun 3, 2021 - Study finds that podcast listening habits mirror TV watching habits, but podcasts are a more effective ad environment, presenting a new opportunity for... https://pubmed.ncbi.nlm.nih.gov/20596023/ The male mouse pheromone ESP1 enhances female sexual receptive behaviour through a specific... Various social behaviours in mice are regulated by chemical signals called pheromones that act through the vomeronasal system. Exocrine gland-secreting peptide... https://research.manchester.ac.uk/en/publications/theory-of-spatial-position-and-spatial-frequency-relations-in-the/ Theory of spatial position and spatial frequency relations in the receptive fields of simple cells... https://www.oicmovies.com/ OIC Movies for ASL Study | The best videos in American Sign Language for receptive practice | The best videos in American Sign Language for receptive practice https://www.tensorflow.org/versions/r1.15/api_docs/python/tf/contrib/receptive_field Module: tf.contrib.receptive_field | TensorFlow v1.15.0 moduletfcontribreceptivefield https://reframing-autism-s-school.teachable.com/courses/reframingautisticcommunicationcommunity/lectures/59335075 Common Autistic Receptive Language Differences | Reframing Autism Suited to anyone wishing to further their knowledge of Autistic communication and socialisation. receptive languagecommonautisticdifferencesreframing https://pubmed.ncbi.nlm.nih.gov/28638003/ Molecular and cellular events during blastocyst implantation in the receptive uterus: clues from... The success of implantation is an interactive process between the blastocyst and the uterus. Synchronized development of embryos with uterine differentiation... molecular and cellular https://www.swissgrandtours.com/ Receptive Incoming Tour Operator in Switzerland - Swissgrand Swissgrand tours is a premium incoming tour operator in Switzerland. We design tailor-made itineraries, guided tours, luxury travel experiences, and... incoming tour operatorreceptiveswitzerland https://ca.billboard.com/fyi/strumbellas-find-receptive-audience-their-salvation Strumbellas Find Receptive Audience For Their 'Salvation' | Billboard Canada Nov 8, 2023 - The following are tracks delivered to radio by digital distributor DMDS/Yangaroo in Canada and broken down into two categories. strumbellasfindreceptiveaudiencesalvation https://legal.economictimes.indiatimes.com/news/international/supreme-court-appears-receptive-to-nra-free-speech-lawsuit-against-a-former-new-york-state-official/108627575 New York State Department Of Financial Services: Supreme Court appears receptive to NRA free-speech... New York State Department Of Financial Services: Supreme Court justices appeared receptive Monday to National Rifle Association claims that a former New York... https://pubmed.ncbi.nlm.nih.gov/33692544/ Inter-mosaic coordination of retinal receptive fields intermosaiccoordinationretinalreceptive https://pure.psu.edu/en/publications/incidental-receptive-language-growth-associated-with-expressive-g/ Incidental receptive language growth associated with expressive grammar intervention in SLI - Penn... receptive languageassociated with https://gritsforbreakfast.blogspot.com/2014/04/consultant-tdcj-receptive-to-prison.html Grits for Breakfast: Consultant: TDCJ 'receptive' to prison rape recommendations, 'confident'... The Texas Department of Criminal Justice (TDCJ) this week sent me the consultant's report regarding what would be required for Texas' adult... grits for breakfastprison rapeconsultanttdcj https://vtechworks.lib.vt.edu/items/4177a058-2944-4181-a283-3dc3db11e49e Algorithms for Distributionally Risk-Receptive and Robust Stochastic Integer Programs and... This dissertation advances the theory and algorithms of stochastic mixed-integer programs under distributional ambiguity, with a particular focus on... algorithmsriskreceptiverobuststochastic https://endoflife.weill.cornell.edu/publications/mobile-health-technology-here-are-hospice-informal-caregivers-receptive Mobile Health Technology Is Here-But Are Hospice Informal Caregivers Receptive? | Center for... https://op.europa.eu/en/web/public-procurement/procurement-details/-/procurement/0595dc03-3612-4185-981e-cc9df64aef0e SUPPLY AND DELIVERY OF SURGELED COCKTAIL PARTS FOR THE RECEPTIVE ACTIVITIES OF THE CITY OF NANTES -... supply and delivery https://receptivemedia.co.uk/ Receptive Media | Web, AI & Digital Products We build the websites, integrations and AI tools that help your business run better. media webai digitalreceptiveproducts https://cliengage.atlassian.net/wiki/spaces/USE/pages/422347133/TX-KEA+Is+it+possible+to+view+TX-KEA+scores+for+receptive+and+expressive+separately+instead+of+combining+them KPM: Is it possible to view KPM scores for receptive and expressive separately instead of combining... https://kuscholarworks.ku.edu/entities/publication/9fdbb47d-b886-43bf-b6cd-a86dce0f8301 The Effects of Intertrial Intervals on Receptive Tasks for Young Children with Autism A small number of studies have evaluated the effects of different lengths of intertrial intervals on the speed of learning and found that shorter durations of... https://drum.lib.umd.edu/items/d0a301ee-e7d5-4ba6-ac0f-771597a4c386/full Control System Sensor Failure Detection via Networks of Localized Receptive Fields This paper investigates the use of local receptive field networks (LRFN) in detecting sensor failures of a control system in the presence of model-plant... control systemfailure detectionsensor https://publications-cnrc.canada.ca/fra/voir/objet/?id=af75b51e-7ce2-47f3-be99-42c562d48f4d Receptive field size for certain neurons in primary somatosensory cortex is determined by... Receptive field size for certain neurons in primary somatosensory cortex is determined by GABA-mediated intracortical inhibition https://women-in-language.teachable.com/courses/women-in-language-2022/lectures/37830407 14:00 GMT Receptive Bilinguals: When Bilingual Children Understand Join us for our fifth Women in Language, an online event created to champion, celebrate and amplify female and non-binary voices in language learning. bilingual childrengmtreceptiveunderstand https://glrtours.com/ Student Tours - GLR Tours - Receptive and College Tours Apr 7, 2025 - GLR Tours operates student and college tours for middle, high school, and college, groups tours, and full receptive services throughout the US student toursglrreceptivecollege https://is.mpg.de/publications/item_2608538 Estimating average single neuron receptive field sizes in human primary visual cortex | MPI-IS https://eric.ed.gov/?id=EJ1058998 ERIC - EJ1058998 - Value-Added Predictors of Expressive and Receptive Language Growth in Initially... Eighty-seven preschoolers with autism spectrum disorders who were initially nonverbal (under 6 words in language sample and under 21 parent-reported words... https://language-centre.rug.nl/en/course-language-centre/receptive-dutch-2-for-the-consultative-participation-body Receptive Dutch 2 for the consultative participation body - Language centre We are offering Receptive Dutch courses specifically for international members of consultative participation bodies at the University of Groningen. In these... for thebody languagereceptivedutchconsultative https://www.salon.com/2024/07/18/do-the-right-thing-biden-more-receptive-to-dropping-out-as-top-allies-warn-hes-sinking-party/ "Do the right thing": Biden "more receptive" to dropping out as top allies warn he's sinking party... Jul 18, 2024 - Democrats Nancy Pelosi, Chuck Schumer and Hakeem Jeffries urged Biden to step aside as polls show him tanking. https://www.theepochtimes.com/us/mccarthy-receptive-to-measure-requiring-state-media-outlets-covering-house-to-register-as-foreign-agents-gop-rep-5142015 McCarthy Receptive to Measure Requiring State Media Outlets Covering House to Register as Foreign... https://www.waisman.wisc.edu/publications/conceptual-scoring-of-receptive-and-expressive-vocabulary-measures-in-simultaneous-and-sequential-bilingual-children/ Conceptual scoring of receptive and expressive vocabulary measures in simultaneous and sequential... Kaushanskaya, PhD, M. Conceptual Scoring of Receptive and Expressive Vocabulary Measures in Simultaneous and Sequential Bilingual Children. Gross M, Buac M,... conceptualscoringreceptive https://research.manchester.ac.uk/en/publications/nonlinear-population-receptive-field-changes-in-human-area-v5mt-o/ Nonlinear population receptive field changes in human area V5/MT+ of healthy subjects with... https://eric.ed.gov/?id=EJ1153926 ERIC - EJ1153926 - Receptive Multilingualism at School: An Uneven Playing Ground?, International... In this article, we present an analysis of individual factors that influence how well a person can read and understand a text in an unfamiliar, but closely... at schoolplaying groundericreceptivemultilingualism https://pmc.ncbi.nlm.nih.gov/articles/PMC6772912/ Interspike Intervals, Receptive Fields, and Information Encoding in Primary Visual Cortex - PMC In the primate primary visual cortex (V1), the significance of individual action potentials has been difficult to determine, particularly in light of the... https://arxiv.org/abs/2011.08577v2 [2011.08577v2] Multi Receptive Field Network for Semantic Segmentation Abstract page for arXiv paper 2011.08577v2: Multi Receptive Field Network for Semantic Segmentation multireceptivefieldnetworksemantic https://www.windowscentral.com/logmein-receptive-windows-phone-7-development LogMeIn receptive to Windows Phone 7 development | Windows Central Feb 15, 2011 - The latest News,/news,,news, breaking news, comment, reviews and features from the experts at Windows Central windows phonelogmeinreceptivedevelopmentcentral https://dash.harvard.edu/entities/publication/1b36761e-c3af-4dba-b9da-749589ae33da The Learning Hypothesis on Spatial Receptive Field Remapping The spatial pattern of grid cells changes due to information such as the location of rewards. Past research has discovered that after rats learn the location... the learninghypothesisspatialreceptivefield https://imperfectcognitions.blogspot.com/2024/01/receptive-publics.html Receptive Publics A blog about imperfect cognitions, such as delusional beliefs, distorted memories, confabulatory explanations, and implicit biases. receptivepublics https://mne.tools/stable/auto_tutorials/machine-learning/30_strf.html Spectro-temporal receptive field (STRF) estimation on continuous data — MNE 1.12.1 documentation https://pubmed.ncbi.nlm.nih.gov/1337104/?dopt=Abstract Effects of membrane voltage on receptive field properties of lateral geniculate neurons in the cat:... 1. Thalamic relay cells, including those of the lateral geniculate nucleus, display a low-threshold spike (LT spike), which is a large depolarization due to an... https://www.wikidata.org/wiki/Q34053190 Receptive fields and functional architecture of monkey striate cortex - Wikidata functional architecturereceptivefieldsmonkeycortex https://gritsforbreakfast.blogspot.com/2009/07/does-receptive-climate-toward.html?showComment=1246963922439 Grits for Breakfast: Does a receptive climate toward immigrants reduce crime? Radley Balko at Reason thinks he has an answer for why El Paso ranks among the safest large cities in America: "If you want to find a safe ... grits for breakfast https://www.cordis.europa.eu/project/id/101064539/it The role of layer-specific population receptive field properties in visual recurrent processing |... Visual perception has long been cast as an inference process, in which feedforward sensory signals are integrated with expectation-related feedback. For every... https://swachhindia.ndtv.com/air-pollution-stubble-burning-younger-generation-more-receptive-to-alternatives-than-elders-bhurelal-28078/ Stubble Burning: Younger Generation More Receptive To Alternatives Than The Elders, Says EPCA... Nov 20, 2018 - Stubble burning was more than expected even after strict enforcement, said the Environment Pollution (Prevention and Control) Authority (EPCA) Chairperson,... https://kth.diva-portal.org/smash/record.jsf?pid=diva2%3A451227&dswid=6589 Object recognition using composed receptive field histograms of higher dimensionality object recognitionusingcomposedreceptivefield https://boris-portal.unibe.ch/entities/publication/cdea34d7-22d2-4de2-9baf-70800f972411 Under what contextual and situational conditions are policies receptive to change? A Qualitative... https://padlet.com/luxstrasse/reading-receptive-skill-nwwh6uhd39e7 Reading: receptive skill How can I help my students improve their reading? readingreceptiveskill https://hig.diva-portal.org/smash/record.jsf?pid=diva2:1964350 The Effects of Multimodality on Receptive Vocabulary Acquisition Through Read-Alouds in the Swedish... https://researchdiscovery.drexel.edu/esploro/outputs/graduate/The-concomitant-use-of-preferred-receptive/991014632562904721 The concomitant use of preferred receptive listening and processing at the end of life - Drexel... The purpose of this study is to develop a new model of music therapy. Multiple sources have documented the need for an environment that is open and comfortable... https://india.entrepreneur.com/news-and-trends/customers-are-very-receptive-to-working-with-startups-says/275257 Customers Are Very Receptive To Working With Startups, Says Microsoft Ventures Oct 4, 2025 - Changes in the environment will help in the maturing of the ecosystem working withcustomersreceptive https://www.mpg.de/8219168/music-pregnancy Receptive to music | Max-Planck-Gesellschaft Pregnant women respond to music with stronger physiological changes in blood pressure. max planckreceptivemusicgesellschaft https://www.merriam-webster.com/sentences/receptive Examples of 'RECEPTIVE' in a Sentence | Merriam-Webster 'Receptive' in a sentence: I was happy to be speaking before such a receptive audience. in a sentenceexamples ofreceptivemerriamwebster https://teachingenglishwithoxford.oup.com/2013/05/21/12-ways-boost-language-skills-independent-learning/receptive-skills/ Receptive Skills - Teaching English with Oxford teaching englishreceptiveskillsoxford https://sfzc.teachable.com/courses/bendowa-dogen-and-the-practice-of-zazen/lectures/52203303 2.3 Receptive Samadhi and Zazen | SFZC Online Learning sfzc onlinereceptivesamadhizazenlearning https://publications-cnrc.canada.ca/eng/view/object/?id=fa2c3f5a-300a-4d6a-b05c-c853261457e1 Receptive-field size of S1 cortical neurones is altered by methaqualone via a GABA mechanism - NRC... Receptive-field size of S1 cortical neurones is altered by methaqualone via a GABA mechanism https://pubmed.ncbi.nlm.nih.gov/34409987/ Measuring Receptive ASL Skills in Novice Signers and Nonsigners We tested the utility of two standardized measures of receptive skills in American Sign Language (ASL) in hearing adults who are novice signers: the ASL... measuringreceptiveaslskillsnovice https://speechroomnews.blogspot.com/2012/11/winter-expressive-and-receptive-language.html Speech Room News: Winter Expressive and Receptive Language speech roomnewswinterexpressivereceptive https://ilo.wikipedia.org/wiki/Receptive_field?action=edit&redlink=1 Agparpartuat iti Receptive field - Wikipedia, ti nawaya nga ensiklopedia itireceptivefieldwikipedianawaya https://www.semanticscholar.org/topic/Receptive-Expressive-Language-Treatment-using/10807249 Receptive/Expressive Language Treatment using Augmentative / Alternative Communication Equipment |... expressive languagealternative communicationreceptivetreatmentusing https://eprints.ncl.ac.uk/289359 Tissue-type plasminogen activator induces conditioned receptive field plasticity in the mouse... https://ies.ed.gov/use-work/resource-library/report/evaluation-report/longitudinal-view-receptive-vocabulary-and-math-achievement-young-children-disabilities?pubid=NCSER20113006 A Longitudinal View of the Receptive Vocabulary and Math Achievement of Young Children with... This report describes how children who received preschool special education services perform over time on assessments of receptive vocabulary and math skills.... https://pubmed.ncbi.nlm.nih.gov/38485258/ Visual Corticotectal Neurons in Awake Rabbits: Receptive Fields and Driving Monosynaptic... The superior colliculus receives powerful synaptic inputs from corticotectal neurons in the visual cortex. The function of these corticotectal neurons remains... visualneuronsawake https://cordis.europa.eu/project/id/101059893/reporting/fr Relationships of receptive grammar acquisition with musical rhythm processing and executive... Latest report summary relationshipsreceptivegrammaracquisition https://kuscholarworks.ku.edu/entities/publication/70ae5ea5-0ab3-487a-9d02-fae341e13e6e Alternative Receptive Language Assessment Modalities and Stimuli for Children with ASD who are... There are very few receptive language measures that are appropriate for children with autism spectrum disorders (ASD) who have minimal verbal skills. The... https://algeria-dmc.com/ Algeria Dmc - Receptive and Private Tour Operator in Algeria Mar 27, 2026 - Algeria Dmc is a receptive and a Private Tour Operator in Algeria We have an office in Algiers and also an office in Europe in Marseille.... private touralgeriadmcreceptiveoperator https://pubmed.ncbi.nlm.nih.gov/9465109/ Rapping, a female receptive call, initiates male-female duets in the South African clawed frog Finding a sexually receptive partner of the opposite sex is a challenge; one solution is to advertise. That advertising is usually the province of males has... https://ppls-staff.ppls.ed.ac.uk/blog/2026/05/07/customer-support-is-actually-examined-right-to-observe-how-helpful-and-you-may-receptive-it-is-used/ Customer support is actually examined right to observe how helpful and you may receptive it is used... https://www.imperial.ac.uk/neurotechnology/training/cdt/projects/astrocytes/ Characterising receptive fields of astrocytes in auditory cortex | Research groups | Imperial... Andrei Kozlov (Bioengineering)Simon Schultz (Bioengineering)Claudia Clopath (Bioengineering) auditory cortexresearch groupsreceptivefieldsastrocytes https://pubmed.ncbi.nlm.nih.gov/37152925/ Endometrial whole metabolome profile at the receptive phase: influence of Mediterranean Diet and... The study findings provide insight into the molecular background of female infertility and lead to identification of potential molecular biomarkers and... https://eric.ed.gov/?id=EJ117596 ERIC - EJ117596 - MIRA: A Concept in Receptive Language Assessment of Bilingual Children, Language,... mira a https://artemkirsanov.substack.com/ Receptive Field | Artem Kirsanov | Substack A weekly curation of thoughts on biological and artificial intelligence. Click to read Receptive Field, by Artem Kirsanov, a Substack publication with... artem kirsanovreceptivefieldsubstack https://www.business-standard.com/world-news/ecb-to-cut-rates-stay-receptive-to-further-easing-amid-growth-concerns-125013000198_1.html ECB to cut rates, stay receptive to further easing amid growth concerns | World News - Business... With the euro zone suffering through an industrial recession and weak consumption, the case for a cut is so clear that none of the ECB's 26 policymakers have... https://experts.arizona.edu/en/publications/receptive-field-organization-of-units-in-the-first-optic-ganglion/ Receptive field organization of units in the first optic ganglion of diptera - University of Arizona https://eric.ed.gov/?id=EJ154937 ERIC - EJ154937 - Selected Factors Related to Receptive Language Ability of Culturally Different... Describes study of relationship between seven specific factors and receptive language development of fourth and seventh grade culturally-different students.... https://sh.diva-portal.org/smash/record.jsf?pid=diva2:1243418 "Intuitive, receptive, dark": Negotiations of femininity in the contemporary Satanic and Left-hand... https://www.mis.mpg.de/de/publications/preprint-repository/article/2001/issue-11 Nonlinear analysis of spatio-temporal receptive fields II Dynamic properties of V1 simple cells MiS... Delve into the future of research at MiS with our preprint repository. Our scientists are making groundbreaking discoveries and sharing their latest findings... https://gritsforbreakfast.blogspot.com/2009/07/does-receptive-climate-toward.html?showComment=1246977500197 Grits for Breakfast: Does a receptive climate toward immigrants reduce crime? Radley Balko at Reason thinks he has an answer for why El Paso ranks among the safest large cities in America: "If you want to find a safe ... grits for breakfast https://su.diva-portal.org/smash/record.jsf?pid=diva2:1468437 Amount of speech exposure early in infancy is related to receptive vocabulary size at twelve months https://edoc.ub.uni-muenchen.de/3764/ Lateral Interactions and Receptive Field Structure of Lobula Plate Tangential Cells in the Blowfly https://experts.illinois.edu/en/publications/receptive-methods-in-child-bilingualism-and-second-language-acqui/fingerprints/?sortBy=alphabetically Receptive methods in child bilingualism and second language acquisition - Fingerprint - Illinois... second language acquisitionreceptivemethodschildbilingualism https://eric.ed.gov/?id=ED553050 ERIC - ED553050 - Analyses of Receptive and Productive Korean EFL Vocabulary: Computer-Based... The present research study investigated the effects of 8 versions of a computer-based vocabulary learning program on receptive and productive knowledge levels...