https://www.send2press.com/wire/secugen-to-showcase-new-unity-20-bluetooth-fingerprint-reader-at-the-rsa-conference-2019/
SecuGen to Showcase New Unity 20 Bluetooth Fingerprint Reader at the RSA Conference 2019 -...
Feb 18, 2019 - SANTA CLARA, Calif., Feb. 18, 2019 (SEND2PRESS NEWSWIRE) -- SecuGen, a world leading optical fingerprint device and technology vendor, is pleased to announce...
bluetooth fingerprint readerrsa conferenceshowcasenewunity
https://www.helpnetsecurity.com/2016/03/01/photo-gallery-rsa-conference-2016/
Photo gallery: RSA Conference 2016 - Help Net Security
Mar 1, 2016 - The RSA Conference 2016 is underway at the Moscone Center in San Francisco. Here are a few photos of the first day of the conference, with the Expo Floor
help net securityphoto galleryrsa conference
https://fedscoop.com/tag/rsa-conference/
RSA Conference Archives | FedScoop
rsa conferencearchivesfedscoop
https://theworldnewswire.com/article/807422529-red-piranha-named-winner-of-the-coveted-global-infosec-awards-during-rsa-conference-2025
Red Piranha Named Winner of the Coveted Global InfoSec Awards during RSA Conference 2025 | The...
The World Newswire is an online news publication focusing on the World: The latest news on global issues
winner of thersa conferenceredpiranhanamed
https://www.techtarget.com/searchsecurity/news/366585432/Risk-Repeat-Recapping-RSA-Conference-2024
Risk & Repeat: Recapping RSA Conference 2024 | TechTarget
rsa conferenceriskrepeat
https://www.eset.com/us/about/newsroom/press-releases/eset-research-at-rsa-conference-2021-android-stalkerware-on-the-rise-2/
ESET Research at RSA Conference 2021: Android Stalkerware on the rise | | ESET
on the riseeset researchrsa conferenceandroidstalkerware
https://www.computerweekly.com/event/RSA-Conference-2019-Asia-Pacific-Japan
RSA Conference 2019 Asia Pacific & Japan
rsa conferenceasia pacificjapan
https://www.imprivata.com/uk/company/press/imprivata-wins-three-coveted-global-infosec-awards-rsa-conference-2024
Imprivata Named Winner of Three Coveted Global InfoSec Awards during RSA Conference 2024 |...
Imprivata wins multiple awards for state-of-the-art Passwordless Authentication and biometrics solutions in 12th Annual Global InfoSec Awards at #RSAC 2024.
rsa conferenceimprivatanamedwinnerthree
https://www.orangecyberdefense.com/global/events/90-of-domestic-accidents-happen-at-home
RSA Conference 2021 Panel discussion
How can you ensure the security of the remote workforce? Watch the discussion with Geoff White, Charl van der Walt, Wicus Ross and Gilles van Heijst.
rsa conferencepanel discussion
https://blogs.cisco.com/tag/rsa-conference-2
RSA Conference - Cisco Blogs
rsa conferenceciscoblogs
https://tv.nyse.com/rsa-conference-2025/videos/vanta-cro-stevie-case-at-rsac-2025
Vanta CRO Stevie Case at RSAC 2025 - RSA Conference 2025 - New York Stock Exchange - An Ice Exchange
Vanta CRO Stevie Case at RSAC 2025
rsa conferencenew yorkstock exchangevantacro
https://berkerynoyes.com/key-takeaways-from-the-2024-rsa-conference/
Key Takeaways from the 2024 RSA Conference - Berkery, Noyes & Co., LLC.
key takeawaysfrom thersa conferencenoyesllc
https://taosecurity.blogspot.com/2005/10/bejtlich-speaking-at-rsa-conference.html?showComment=1131072240000
Bejtlich Speaking at RSA Conference 2006
Richard Bejtlich's blog on digital security, strategic thought, and military history.
rsa conferencespeaking
https://infosec-conferences.com/event/20260323-rsa-conference-usa-2026/
RSA Conference USA 2026, San Francisco, United States | Concise AC
RSA Conference USA 2026 takes place on 23 March 2026 in San Francisco, United States. Format: Physical.
rsa conferencesan franciscounited statesusaconcise
https://www.eventible.com/it/rsa-conference
Reviews for RSA Conference 2023 , US | Eventible
rsa conferencereviewsus
https://neuronamagazine.com/tag/rsa-conference-2025/
RSA CONFERENCE 2025 archivos - Neurona Magazine
rsa conferencearchivosmagazine
https://www.eddies-list.com/p/rsa-conference-side-events/comments
Comments - 2026 RSA Conference Side Events, Happy Hours, Networking Opportunities
RSA Conference Events San Francisco, RSA Networking Events San Francisco, RSA After Parties San Francisco, RSA Side Events, RSA Happy Hours, RSA Hackathons
rsa conferenceside eventshappy hoursnetworking opportunitiescomments
https://securosis.com/blog/rsa-conference-guide-2013-network-security/
RSA Conference Guide 2013: Network Security - Securosis
Jan 2, 2024 - After many years in the wilderness of non-innovation, there has been a lot of activity in the network security space over the past few years. Your...
rsa conferencenetwork securityguide
https://www.paloaltonetworks.com/blog/2017/02/cso-takeaways-rsa-conference-2017/
CSO Takeaways from RSA Conference 2017
Feb 28, 2017 - Palo Alto Networks CSOs were on the scene at RSA Conference 2017. Here are their thoughts on the most interesting conversations and takeaways.
rsa conferencecsotakeaways
https://www.ox.security/newsroom/ox-security-named-winner-of-the-coveted-global-infosec-awards-during-rsa-conference-2024/
OX Security Named Winner of the Coveted Global InfoSec Awards during RSA Conference 2024 | OX...
Mar 18, 2026 - OX Security wins Global InfoSec Awards at RSA Conference 2024, highlighting its leadership and innovation in application security solutions.
winner of theox securityrsa conferencenamedcoveted
https://saviynt.com/de/press-release/saviynt-brings-platform-centric-identity-security-to-center-stage-at-rsa-conference-2025?hsLang=de
Saviynt Brings Platform-Centric Identity Security to Center Stage at RSA Conference 2025
identity securitycenter stagersa conferencesaviyntbrings
https://www.itnews.com.au/news/anonymous-victim-bolts-from-rsa-conference-248479
Anonymous victim bolts from RSA conference - iTnews
HBGary alleges threats of physical violence.
rsa conferenceanonymousvictimboltsitnews
https://dynamicsfocus.com/6588/onapsis-showcases-latest-erp-cybersecurity-research-during-rsa-conference-2018/
Onapsis Showcases Latest ERP Cybersecurity Research During RSA Conference 2018 - DynamicsFocus
Apr 10, 2018 - Onapsis, the global experts in SAP and Oracle application cybersecurity and compliance, today announced that it will be attending the 2018 RSA Conference in...
cybersecurity researchrsa conferenceonapsisshowcaseslatest
https://cybersecuritymarket.com/rsa-conference-2020-apj-unveils-keynote-line-up-july-15-17-2020-singapore-time/
RSA Conference 2020 APJ Unveils Keynote Line-up, July 15-17, 2020, Singapore Time | Cybersecurity...
rsa conferenceline upapjkeynotejuly
https://www.pluralsight.com/resources/blog/cybersecurity/how-attend-rsa-conference
How to tackle the RSA Conference: Deciding what to attend | Pluralsight
At the RSA Conference, there's no possible way to see and do everything. Here's our advice on how to figure out where to spend your time at the event.
how torsa conferencetackledecidingattend
https://cybersecurityventures.com/luminary-cryptographers-reminisce-about-the-first-rsa-conference/
Luminary Cryptographers Reminisce About The First RSA Conference
Nov 18, 2024 - This week in cybersecurity from the editors at Cybercrime Magazine
the firstrsa conferenceluminaryreminisce
https://blog.qualys.com/misc/2015/03/09/call-for-customer-presenters-in-qualys-booth-at-rsa-conference-2015
Call for Customer Presenters in Qualys Booth at RSA Conference 2015 | Qualys
Sep 7, 2020 - Are you a Qualys customer with an interesting story to tell about how Qualys has helped your organization improve its security posture? If yes, we would love...
rsa conferencecallcustomerpresentersqualys
https://cpl.thalesgroup.com/blog/identity-data-protection/rsa-conference-2023-cyber-security-summit
RSA Conference 2023 - Where World Talks Cybersecurity
RSA Conference 2023 with the slogan "Stronger Together", strives toward collaboration of cybersecurity organizations for a safer world for us and our children.
rsa conferenceworldtalkscybersecurity
https://redcanary.com/blog/opinions-insights/previewing-rsa-conference-10-talks-to-attend/
Previewing RSA Conference: 10 Talks to Attend | Red Canary
RSA Conference can be daunting, so we created a guide highlighting ten information security talks we look forward to at the conference.
rsa conferencered canarypreviewingtalksattend
https://www.nextbigfuture.com/2026/03/ciso-whisperer-names-11-vendors-leading-the-shift-from-tools-to-outcomes-at-rsa-conference-2026.html
CISO Whisperer Names 11 Vendors Leading the Shift from Tools to Outcomes at RSA Conference 2026 |...
Mar 19, 2026 - Austin, United States, 19th March 2026, CyberNewswire
the shiftfrom toolsrsa conferencecisowhisperer
https://contra.com/p/Bv3FcBX7-rsa-conference-2023
RSA Conference 2023 by Bennette Sebastian
Designed and delivered all content for screens at 13,000 pixels across.
rsa conferencesebastian
https://www.dlt.com/blog-tags/rsa-conference
RSA Conference | TD SYNNEX Public Sector
rsa conferencetd synnexpublic sector
https://www.semperis.com/de/resources/marty-momdjian-discusses-ready1-with-ismg-at-rsac-2025/
ISMG interviewt Alex Weinert auf der RSA Conference 2025
Dec 24, 2025 - Bei RSAC interviewte Anna Delaney Alex Weinert, den neuen Chief Product Officer bei Semperis, der von einer herausragenden Position bei Microsoft wechselte....
rsa conferenceismgalexweinertauf
https://fidoalliance.org/rsa-conference-wrap-up-fido-authentication-grabs-the-attention-of-c-suite-executives/?query-cdbd12d0-page=3&cst
RSA Conference Wrap Up: FIDO Authentication Grabs the Attention of C-Suite Executives | FIDO...
Apr 28, 2025 - Andrew Shikiar, Senior Director of Marketing, FIDO Alliance
rsa conferencewrap upfido authenticationgrabsattention
https://www.indybay.org/newsitems/2024/05/06/18865919.php
Protest Blinken at RSA Conference 2024 : Indybay
Moscone Center: 747 Howard Street, San Francisco
rsa conferenceprotest
https://www.crn.com/slide-shows/security/229218881/security-goes-platinum-25-scenes-from-rsa-conference-2011
Security Goes Platinum: 25 Scenes From RSA Conference 2011 | CRN
RSA Conference 2011 had a little bit of everything. While it's impossible to see and do it all, here are 25 scenes from the nation's largest information...
rsa conferencesecuritygoesplatinumscenes
https://www.tilleke.com/insights/jeffrey-blatt-speak-rsa-conference-apj-2019/
Jeffrey Blatt to Speak at RSA Conference APJ 2019 - Tilleke & Gibbins
to speakrsa conferencejeffreyblattapj
https://www.biometricupdate.com/page/40?posttype=all&s=RSA+Conference
RSA Conference | Biometric Update - Part 40
rsa conferencebiometric updatepart
https://www.westconcomstor.com/ch/de/news/insights/rsa-conference-2022-needed-now-more-than-ever.html
RSA Conference 2022: needed now more than ever | Westcon-Comstor
RSA Conference 2022 is needed now more than ever. Discover the latest in cybersecurity innovations.
rsa conferencemore thanneededever
https://www.illumio.com/blog/3-things-you-should-be-looking-for-at-rsa-conference-2024
3 Things You Should Be Looking For at RSA Conference 2024 - Illumio Cybersecurity Blog | Illumio
Get insight into how you should be thinking about AI security risks, cloud security, and cybersecurity ROI at RSA Conference 2024.
looking forrsa conferencecybersecurity blogthingsillumio
https://zpesystems.com/company/events/rsa-conference-2025/
RSA Conference 2025 - ZPE Systems -
Aug 28, 2025 - Visit RSA Conference in San Francisco to see how we help the largest organizations automatically recover from ransomware.
rsa conferencezpe systems
https://www.immuniweb.com/events/rsa-conference.html
ImmuniWeb Participates at RSA Conference | ImmuniWeb Events and Conferences
ImmuniWeb will participate at RSA Conference in San Francisco, USA, on May 6 - 9, 2024.
events and conferencesimmuniwebparticipatesrsa
https://www.innovationquarter.nl/en/cisco-supports-dutch-cyber-security-participation-rsa-conference-2021/
Cisco supports Dutch Cyber Security Participation RSA Conference 2021 - Innovationquarter
Jul 14, 2020 - Following the success of the Netherlands Pavilion at the RSA Conference earlier this year in San Francisco, InnovationQuarter in collaboration with the...
cyber securityrsa conferenceciscosupportsdutch
https://www.halock.com/rsa-conference-speaker-session-securing-the-budget/
RSA Conference Speaker Session Securing the Budget - HALOCK
Jul 4, 2024 - Jim Mirochnik presents Securing the Budget You Need! Translating Security Risks to Business Impacts.
rsa conferencethe budgetspeakersessionsecuring
https://delinea.com/blog/rsa-conference-5-top-sessions-to-attend
RSA Conference: 5 Top Sessions to Attend
Going to RSA 2024? Here are the sessions you must not miss! Joseph Carson, Advisory CISO at Delinea, presents his TOP 5 list and tips.
rsa conferencetopsessionsattend
https://securityaffairs.com/56445/hacking/rsa-conference-attendees-hacked.html
RSA Conference 2017 attendees hacked with rogue access points
Feb 19, 2017 - Experts at Pwnie Express discovered multiple rogue access points on the show floor that were used to hack the RSA conference attendees.
rogue access pointsrsa conferenceattendeeshacked
https://finviz.com/news/339793/rsa-conference-2026-varonis-ceo-yaki-faitelson-to-deliver-keynote-on-securing-the-agentic-ai-revolution
RSA Conference 2026: Varonis CEO Yaki Faitelson to Deliver Keynote on Securing the Agentic AI...
Stock screener for investors and traders, financial visualizations.
rsa conferenceagentic aivaronisceodeliver
https://www.anomali.com/events/rsa-conference
RSA Conference
rsa conference
https://www.prweb.com/releases/avepoint_presents_implications_of_the_new_european_general_protection_regulation_at_rsa_conference_2016/prweb13228913.htm
AvePoint Presents Implications of the New European General Protection Regulation at RSA Conference...
San Francisco (PRWEB) February 25, 2016 -- AvePoint Chief Compliance and Risk Officer, Dana Simberkoff, will join Bojana Bellamy, President of the Center for...
the new europeanrsa conferenceavepointpresentsimplications
https://www.domaintools.com/blog/2016-rsa-conference-and-the-domaintools-report
2016 Report on Domain Attributes Age | RSA Conference - DomainTools | Start Here. Know Now.
Read the DomainTools 2016 Report on new domain attributes including age presented at the RSA Conference.
rsa conferencestart herereportdomainattributes
https://www.cisecurity.org/insights/blog/at-long-last-cis-will-be-back-at-rsa-conference-in-2022
At Long Last, CIS Will Be Back at RSA Conference in 2022
May 19, 2022 - For many of us, it was the last in-person industry event we attended before COVID. I'm happy to say that CIS will be back at RSA Conference this year.
rsa conferencelonglastcisback
https://blog.360totalsecurity.com/en/360-total-security-rsa-2016/rsa/
RSA Conference 2016 | 360 Total Security Blog
rsa conferencetotal securityblog
https://researchprofiles.canberra.edu.au/en/activities/2024-joint-anzrsairsa-conference/
2024 Joint ANZRSAI/RSA Conference - University of Canberra Research Portal
university of canberrarsa conferenceresearch portaljoint
https://techspective.net/tag/rsa-conference/
RSA Conference Archives | TechSpective
rsa conferencearchivestechspective