Robuta

https://www.prnewswire.com/news-releases/point-secures-115-million-in-series-c-funding-to-scale-home-equity-platform-and-expand-footprint-301537868.html
/PRNewswire/ -- Point, a fintech company and home equity platform that provides homeowners access to equity financing in exchange for a fractional share of...
series c fundingpointmillionscale
https://gfieurope.org/blog/scale-up-series-part-5-no-offtake-no-scale/
Nov 20, 2025 - In part five of our series to help startups in the alternative protein field grow, we explore how creative offtake strategies, like pre-orders, conditional...
scale upseriespartgfi
https://www.basf.com/global/en/who-we-are/organization/group-companies/BASF_Venture-Capital/publications/2025/251204-ph7
pH7 Technologies Inc., a young company from the portfolio of BASF Venture Capital, today announced the initial closing of USD $25.6 million as part of its...
series btechnologiesraisesmillionscale
https://laughingsquid.com/artist-jr-creates-large-scale-photo-installation-of-nyc-ballet-dancers-for-their-2014-art-series/
French street artist JR created a large-scale photo installation featuring the dancers of New York City Ballet.
large scalenyc balletartistjrcreates
https://www.prnewswire.com/news-releases/cowbell-cyber-raises-20-million-in-series-a-funding-to-scale-ai-powered-cyber-insurance-offering-301245507.html
/PRNewswire/ -- Cowbell Cyber, the industry's first AI-powered cyber insurance provider for small to medium enterprises (SMEs), today announced that it has...
series a fundingcowbellcyberraisesmillion
https://www.vccircle.com/startupadvice-from-series-b-to-scale-a-tech-executive-s-guide-to-platform-engineering
Scaling is not just about adding more servers or moving to Kubernetes. The real transition is from “it works” to “it works at...
series bstartupadvicescaletech
https://www.prnewswire.com/news-releases/chargeafter-raises-44m-in-series-b-from-worlds-leading-banks-to-scale-global-bnpl-financing-network-301507480.html
/PRNewswire/ -- ChargeAfter, the market-leading Buy Now Pay Later (BNPL) consumer financing network that provides shoppers with responsible, approved...
in seriesraisesbworldleading
https://www.prnewswire.com/news-releases/yardstik-raises-8m-series-a-to-scale-its-human-security-platform-301474418.html
/PRNewswire/ -- Yardstik, a technology company offering screening, verification, and training solutions tailored to gig marketplaces and SaaS platforms,...
series aits humanraisesscalesecurity
https://pulse2.com/ai-one-7-million-series-a-closed-to-scale-enterprise-ai-infrastructure/
Nov 27, 2025 - AI One has raised $7 million in Series A funding, bringing its total capital secured to $11 million as the company ramps up work with Fortune 500 enterprises...
series aaionemillionclosed
https://fortune.com/2025/12/16/valerie-health-raises-30-million-series-a-to-scale-ai-front-offices-for-physicians/
Dec 16, 2025 - Valerie Health has raised its $30 million Series A, led by Redpoint Ventures, Fortune has exclusively learned.
series avaleriehealthraisesmillion
https://content.bettsrecruiting.com/scale-4-checklist
The Executive Hiring Checklist has all you need to know to hire your next executive. Get all the steps for interviews, salary, mapping out goals and more.
scale seriesbettspartchecklist
https://www.business-standard.com/companies/start-ups/whizzo-raises-15-mn-in-series-a-round-to-scale-technical-textiles-platform-126012001006_1.html
Fundamentum-led Series A backs materials-science research, in-house IP and expansion of an Asia-wide manufacturing network: Whizzo Series A funding
series a roundraisesmnscale
https://ew.com/stranger-things-series-finale-large-in-scale-gotta-go-out-in-big-way-11875154
The Duffer Brothers and select stars tease what's coming in the 2-hour-plus conclusion to 'Stranger Things': 'We gotta go out in a big way.'
stranger thingsseries finalelarge
https://www.automatedwarehouseonline.com/outrider-scale-autonomous-yard-trucks-series-d-funding/
Oct 24, 2024 - Outrider has worked with customers to prove and grow commercial deployments of its autonomous trailer-moving systems.
series d fundingoutriderscaleautonomousyard
https://oshihealth.com/newsroom/press-releases/oshi-health-raises-30m-series-b-funding-to-scale-access-to-its-virtual-multidisciplinary-digestive-care/
Mar 6, 2025 - New investor Koch Disruptive Technologies joins existing investors to reinforce Oshi’s market lead and address surging demand from patients, employers,...
series b fundingoshihealthraisesscale
https://newyork.hoteledition.cn/newsdetail-823368.html
The New York EDITION official website,The New York EDITION reserve ,The New York EDITION conference room reserve,The New York EDITION is located in 5 Madison...
series araisesusmillionscale
https://www.scalesoundsystems.com/rectify?page=4
sound systemsrectifyseriesspeakersscale
https://yoover.com/shop/scoopa-di-fuego-green-6-of-6-hot-wheels-hw-marvel-series-164-scale-collectible-die-cast-model-car/
Scoopa Di Fuego Green #6 of 6 Hot Wheels HW MARVEL Series 1:64 Scale Collectible Die Cast Model Car
hot wheelsdifuegogreenhw
https://openreview.net/forum?id=g5LU1pdKX8&referrer=%5Bthe%20profile%20of%20Junpeng%20Wang%5D(%2Fprofile%3Fid%3D~Junpeng_Wang1)
Spatio-temporal data, which commonly arise in real-world applications such as traffic monitoring, financial transactions, and ride-share demands, represent a...
time series forecastingcompact modellarge scale
https://pertamuda.id/workshop
workshopseriesseedscale
https://openreview.net/forum?id=sFbTM7D1hO&referrer=%5Bthe%20profile%20of%20Lunting%20Fan%5D(%2Fprofile%3Fid%3D~Lunting_Fan2)
Time series anomaly detection is of significant importance in many real-world applications, including finance, healthcare, network security, industrial...
multivariate time seriesanomaly detectionlarge scalebenchmarkingreal
https://www.businesswire.com/news/home/20250916619423/en/CreatorDB-Secures-Oversubscribed-%244.7M-Series-A-to-Scale-Vertical-AI-Infrastructure-for-the-Global-Creator-Economy
CreatorDB, the company building the vertical AI infrastructure for the influencer marketing ecosystem, today announced it has closed an oversubscribed $4.67 ...
series aoversubscribedscalevertical
https://www.businesswire.com/news/home/20250128292418/en/Helion-Announces-%24425M-Series-F-Investment-to-Scale-Commercialized-Fusion-Power
Helion, a fusion energy company, today announced a $425 million Series F investment round that will be used to scale commercialization efforts for the compan...
helionannouncesseriesfinvestment
https://openreview.net/forum?id=OPOBV0zXu7&referrer=%5Bthe%20profile%20of%20Ponnuthurai%20Nagaratnam%20Suganthan%5D(%2Fprofile%3Fid%3D~Ponnuthurai_Nagaratnam_Suganthan2)
Time series foundation models (TSFMs) demonstrate impressive zero-shot performance for time series forecasting. However, an important yet underexplored...
time seriesfoundation modelsmultiscalefinetuning