https://www.epj-conferences.org/articles/epjconf/ref/2024/05/epjconf_chep2024_04001/epjconf_chep2024_04001.html
A holistic study of the WLCG energy needs for the LHC scientific program | EPJ Web of Conferences
EPJ Web of Conferences, open-access proceedings in physics and astronomy
energy needsscientific programweb conferencesholisticstudy
https://www.longdom.com/managementscience/agenda
Scientific Program | Management Science Conference
Oral Presentations involving the theme will be organized at Longdom Conferences across the globe to present their original research.
scientific programmanagement scienceconference
https://publications.mfo.de/handle/mfo/3703/browse?rpp=20&etal=-1&sort_by=-1&type=scientificprogram&starts_with=G&order=ASC
Browsing Workshops 2019 by MFO Scientific Program
scientific programbrowsingworkshopsmfo
https://crgconferences.com/biopolymers/2021/programschedule
Scientific Program | Euro Biopolymers 2021| Bioplastics Congress 2021 | Global Events | Italy |...
scientific programglobal eventseurobiopolymersbioplastics
https://bt1dcongress.org/scientific-program/
Scientific Program | Breakthrough T1D Clinical & Research Congress
scientific programclinical researchbreakthroughcongress
https://www.isuog.org/events/international-symposia/past-meetings-isuog/asia2022/scientific-program.html
Scientific program
Chaired by Prof. Liona Poon and Dr Mary Acda, our Symposium Advisory Group has created a program for International Symposium Asia that reflects local topics...
scientific program
https://ispn.org/news/ispn-2022-have-a-look-at-the-scientific-program/
ISPN 2022 - Have a look at the scientific program - News - ISPN
The scientific program for ISPN 2022 (6-10 December) is now available online. Take the time to peruse the program and pick out which sessions you wish to
have a lookscientific programnews
https://scholarsconferences.com/nanoscience-nanotechnology/scientific-programme-speaker/anis-rahman
Scientific Program | Nanoscience Conferences | Nanotechnology Conferences | Advanced Nanotechnology...
Scholars Conferences invites to all the participants around the globe to World Congress on Nanoscience and Nanotechnology Congress scheduled during 25-26 March...
scientific programnanoscienceconferencesnanotechnologyadvanced
https://www.jadpro.com/issues/volume-11-number-6-aug-2020/gynecologic-cancers-asco20-virtual-scientific-program-highlights-for-the-advanced-practitioner/
JADPRO | Gynecologic Cancers: ASCO20 Virtual Scientific Program Highlights for the Advanced...
gynecologic cancersscientific programfor thevirtualhighlights
https://tlooto.com/paper/149847905430/Scientific-Program
Scientific Program (2013), Chang Andrew | AcademicGPT, tlooto
Functional modeling and experimental measurements on a hydro-pneumatic energy storage system using a rotodynamic pump turbine using a rotodynamic pump turbine....
scientific programchangandrew
https://www.meduniwien.ac.at/web/ueber-uns/events/2024/2nd-vienna-multidisciplinary-symposium-on-antibody-mediated-rejection-after-lung-transplantation/scientific-program/
Scientific Program | MedUni Wien
scientific programwien
https://solaci.org/en/2019/04/17/solaci-congress-2019-discover-the-preliminary-scientific-program/
SOLACI Congress 2019 | Discover the Preliminary Scientific Program | SOLACI
Apr 17, 2019 - We hereby present the preliminary scientific program for the SOLACI-SBHCI 2019 Congress that will take place from August 1st to 3rd at the Frei Caneca
scientific programsolacicongressdiscoverpreliminary
https://www.meetingsint.com/conferences/oncology/scientific-program
Scientific Program | Global Radiation Oncology Meetings | Annual Cancer Biology Conventions |...
Through Scientific Program explore your knowledge at Dubai, UAE in Oncology Conferences. Join us to gain invaluable insights and contribute to the collective...
scientific programradiation oncologycancer biologyglobalmeetings
https://ocpe.mcw.edu/orthopedic/node/193262
21st Annual John S. Gould Lectureship/Scientific Program | Medical College of Wisconsin
21st Annual John S. Gould Lectureship/Scientific Program
john sscientific programmedical collegeannualgould
https://www.fishersci.nl/nl/en/programs-services/new-lab-start-up/program-sponsors/thermo-fisher-scientific.html
Thermo Fisher Scientific Program Sponsor | Fisher Scientific
The Jump Start Program is an exclusive partnership offered by Thermo Fisher Scientific and is designed to help mitigate risk and get set up on time and within...
thermo fisher scientificprogram sponsor
https://www.scitcentralconferences.com/sprogram/international-virtual-seminar-on-covid-19-May
Scientific Program - SciTech Central COVID-19
Scientific Program - SciTech Central COVID-19
scientific programscitechcentralcovid
https://dspace.lu.lv/items/7d80ce3d-cabe-4b3b-b667-db34f17fbc74
1st Congress of Baltic microbiologists, Riga, Latvia, 31.10.-4.11.2012: Scientific Program. Book of...
scientific programcongressbalticmicrobiologistsriga
https://www.gao.gov/products/gao-24-106297
Federal Research: Key Practices for Scientific Program Managers | U.S. GAO
In fiscal year 2021, the federal government funded over $85 billion in basic research as well as early research directed toward a specific practical...
scientific programfederalresearchkeypractices
https://ascopost.com/issues/june-25-2020/asco20-virtual-scientific-program-next-generation-oncology-highlights/
ASCO20 Virtual Scientific Program Next-Generation Oncology Highlights - The ASCO Post
scientific programnext generationvirtualoncologyhighlights
https://oncodaily.com/societies/132294
The preliminary scientific program of ESHCML2024 is available - OncoDaily
Aug 28, 2024 - The preliminary scientific program of ESHCML2024 is available / cancer, CML, D. S. Krause, ESH-ICMLF 26th annual John Goldman conference, ESHCML2024, Jorge
scientific programis availablepreliminaryoncodaily
https://medboard.courses/product-tag/aao-scientific-program-2024/
AAO Scientific Program 2024 Archives | Med Board Courses
scientific programaaoarchivesmedboard
https://dgm.de/friction/2024/program/scientific-program
Scientific program | Friction 2024
scientific programfriction
https://www.themuse.com/jobs/howardhughesmedicalinstitute/senior-director-scientific-program-officer
Senior Director - Scientific Program Officer at Howard Hughes Medical Institute | The Muse | The...
Find our Senior Director - Scientific Program Officer job description for Howard Hughes Medical Institute located in Chevy Chase, MD, as well as other career...
senior directorscientific programhoward hughesthe museofficer
https://ingegneriasismica.com/2026/volume-43-issue-2/scientific-program-design-and-long-term-follow-up-study-of-core-strength-training-for-professional-athletes/
Scientific program design and long-term follow-up study of core strength training for professional...
scientific programlong termfollow upcore strengthtraining for