https://crocheteverything.com/crochet-lake-midnight-shawl-pattern/
Easy Crochet Lake Midnight Shawl Pattern - Crochet Everything
Apr 14, 2024 - Crochet a Lake Midnight Shawl using simple stitches inspired by the night sky. It is perfect for cozy evenings and adds style to any outfit.
easy crochetshawl patternlakemidnighteverything
https://www.ravelry.com/patterns/library/macclesfield-shawl
Ravelry: Macclesfield Shawl pattern by Irina Anikeeva
Get 20% off this pattern by the
shawl patternravelrymacclesfieldirina
https://api.ravelry.com/patterns/library/simple-lace-triangle-shawl
Ravelry: Simple Lace Triangle Shawl pattern by Cathy Payson
Colors seem to flow effortlessly on this easy knit shawl with a timeless look. Red Heart Super Saver Ombre is the yarn that makes the beautiful visual effect...
shawl patternravelrysimplelacetriangle
https://api.ravelry.com/patterns/library/fir-shawl
Ravelry: Fir shawl pattern by Melody Hoffmann
Fir is an asymmetrical shaped shawl, worked from the bottom up (from the largest to the smallest edge).
shawl patternravelryfirmelodyhoffmann
https://www.favecrafts.com/Crochet-Clothes-Patterns/Crochet-Pineapple-Prayer-Shawl-Pattern
Crochet Pineapple Prayer Shawl Pattern | FaveCrafts.com
May 30, 2018 - Although prayer shawls are meant to comfort others, it can also be comforting to you. This Crochet Pineapple Prayer Shawl Pattern is a beautiful prayer shawl...
prayer shawlcrochetpineapplepattern
https://bluestarcrochet.com/rectangle-crochet-shawl/
Free Rectangle Crochet Shawl Pattern - Blue Star Crochet
Sep 8, 2025 - This is a free pattern for a rectangle crochet shawl using beautiful lacy stitch combination creating intricate looking crochet openwork.
crochet shawlfreerectanglepatternblue
https://www.anggraphpatterns.org/2023/08/jack-o-lantern-c2c-shawl-pattern-cal_24.html
Jack-O-Lantern c2c Shawl Pattern CAL Part 2
Jack-O-Lantern c2c Shawl Pattern. Free Halloween crochet stitch along CAL part 2.
jack o lanternshawl patterncalpart
https://www.easycrochetideas.com/crochet-shawls/40-quick-crochet-shawl-free-patterns/attachment/crochet-shawl-pattern-56/
Crochet Shawl Pattern (56) | Easy Crochet Ideas
Aug 17, 2019 - Pattern Link https://makeanddocrew.com/crochet-granny-stitch-shawl-free-pattern/
crochet shawlpatterneasyideas
https://www.ravelry.com/patterns/library/more-than-faroese-shawl
Ravelry: More than Faroese Shawl pattern by Tanja Luescher
Put 3 patterns in your cart and the least expensive one will be free :) No coupon code needed!
more thanshawl patternravelryfaroesetanja
https://www.ravelry.com/patterns/library/triangle-knit-shawl-690
Ravelry: Triangle Knit Shawl pattern by Yarnspirations Design Studio
This knit project is a good pattern for beginners. The techniques include knowing how to cast on, knit, yarn over, and cast off.
shawl patternravelrytriangleknityarnspirations
https://www.kristinomdahl.com/product/brooklynne-crochet-motif-shawl-pattern/
Brooklynne Crochet Motif Shawl Pattern | Free PDF Download
Oct 17, 2025 - Check out Kristin Omdahl's custom crochet patterns! Purchase this Brooklynne Crochet Motif Shawl Pattern. Download free crochet patterns.
crochet motifshawl patternfree pdfdownload
https://patternprincess.com/beginner-triangle-shawl/
"Beginner" Triangle Shawl - Pattern Princess
Mar 27, 2026 - This "beginner" triangle shawl is designed to let the beauty of the yarn shine through. Once you learn the first two row of stitches, you will be able to
shawl patternbeginnertriangleprincess
https://www.ravelry.com/patterns/library/pfeiffer-shawl
Ravelry: Pfeiffer Shawl pattern by Susanna IC
Earth tones, garter stitch, and openwork comprise the beautiful crescent-shaped Pfeiffer Shawl. Manos del Uruguay Silk Blend comes in a variety of stunning...
shawl patternravelrypfeiffersusannaic
https://knittingwithchopsticks.com/gathering-driftwood-crochet-shawl-pattern/?fbclid=IwZXh0bgNhZW0CMTAAAR3v6mBnLYoaeRg7Snk8VF18WQwX68juMnJHmVvDqn0NMxiRhPLiAJfczNg_aem_AdUvQPwncm1czuE2Wf059Y6hpzS3mZ2pm03oevAfdXDCafLVWuXpVcoztDDPHHBt4hXWt4AjoGFoGOh-dXv7p1lQ
Gathering Driftwood Crochet Shawl Pattern | Knitting with Chopsticks
Nov 24, 2025 - Simple yet sophisticated, with just the right warmth, this elegant crochet shawl pattern is sure to dress up any outfit. Find the full pattern here.
crochet shawlgatheringdriftwoodpatternknitting
https://crochetnknitting.com/tag/vest-and-shawl-pattern/
vest and shawl pattern Archives - Crochet & Knitting
shawl patternvestarchivescrochetknitting
https://www.patternstreet.com/knitting/bamboo-wedding-shawl/
Bamboo Wedding Shawl - Pattern Street
Dec 15, 2025 - Need an extra layer to go with a pretty dress? Or perhaps you've got a special event to go to and ne
wedding shawlbamboopatternstreet
https://www.ellisadine.com/product-page/camerons-baby-shawl-vintage-crochet-pattern-pdf
Camerons baby shawl vintage crochet pattern PDF | website
Camerons baby shawl48 inches square - 3 ply woolEnglish crochet termsvintage crochet patternPDF Download
vintage crochetcameronsbabyshawlpattern
https://www.kristinomdahl.com/product/driftwood-horizon-bias-wrap-shawl-ad-free-pdf-crochet-pattern/
Driftwood Horizon Bias Wrap Shawl | Ad-Free PDF Crochet Pattern | Kristin Omdahl
Oct 21, 2025 - Instantly download and begin crocheting the Driftwood Horizon Bias Wrap Shawl | Ad-Free PDF Crochet Pattern with Kristin Omdahl today!
ad free
https://www.undertheolivetreeknits.com/ourshop/prod_7848688-Two-Skein-Shawl-Knitting-Pattern-Includes-Chart-Reading-Tutorials-Dappled-Days-Shawl.html
Dappled Days Shawl - PDF Knitting Pattern
Learn to read knitting charts to knit this cozy shawl pattern
dappleddaysshawlpdfknitting
https://www.wholesalescarvescity.com/product/giraffe-jacquard-shawl-2/
Giraffe Animal Pattern Shawl - Wholesale Scarves City
wholesale scarvesgiraffeanimalpatternshawl
https://www.yarnandmoreinc.com/shop/c/p/CON-Winter-on-Ocracoke-Shawl-Knitting-Pattern---Paper-Version-x66067179.htm
CON-Winter on Ocracoke Shawl Knitting Pattern - Paper Version - 1099223312
Winter on Ocracoke Shawl Pattern - Paper Version
knitting patternconwinterocracokeshawl
https://yourcrochet.com/patterns/sislove-shawl/
SisLove Shawl - Free Crochet Pattern
Discover the elegance of the SisLove Shawl crochet pattern, ideal for creating a stylish accessory. Elevate your wardrobe with this design!
free crochetshawlpattern
https://www.springwools.com/p/king-cole-pattern-5980-shawl-matinee-coat-dress-hat-and-bootees-in-cherished-4ply/kc5980
King Cole Pattern #5980 Shawl, Matinee Coat, Dress Hat & Bootees in Cherished 4Ply
https://www.krishnane.de/listing/632537199/katharina-lace-shawl-pdf-pattern
KATHARINA Lace Shawl (PDF) Pattern
katharinalaceshawlpdfpattern
https://www.theblueboxgirls.com.au/product-page/dinner-shawl-pdf-pattern-8ply
Dinner Shawl PDF Crochet Pattern - 8ply | The Blue Box
crochet patternthe bluedinnershawlpdf
https://aranpatternarchive.com/vintage-ladies-shawl-neck-aran-cardigan/
Vintage Ladies Shawl Neck Aran Cardigan - Aran Pattern Archive
vintageladiesshawlneckaran
https://blog.expressionfiberarts.com/2016/03/18/secret-meadow-crochet-wrap-free-pattern/secret-meadow-shawl-free-crochet-pattern_1937-copy/
secret-meadow-shawl-free-crochet-pattern_1937 copy - Expression Fiber Arts | A Positive Twist on...
https://oombawkadesigncrochet.com/vintage-scalloped-shawl-free-crochet-pattern/
Vintage Scalloped Shawl Free Crochet Pattern
Nov 4, 2025 - Crochet a Lacy Rainy Grey Scarf with a simple one-row repeat. This easy, stashbuster pattern uses Fingering Weight yarn and basic stitches.
free crochetvintagescallopedshawlpattern
https://thefinickystitcher.com/product/70s-scalloped-shawl-crochet-pattern-for-women-evening-wrap/
70s Scalloped Shawl Crochet Pattern for Women, Evening Wrap | the finicky stitcher
Dec 17, 2023 - Vintage 70s Scalloped Shawl Crochet Pattern for Women: Soft scallops, descending layer on layer, form a deep semicircle of luxuriant warmth.
crochet patternfor women
https://www.anniedesigncrochet.com/flora-shawl-one-skein-free-crochet-pattern/
One Skein Shawl Crochet Pattern - Flora - Annie Design Crochet
Sep 6, 2024 - A One Skein Shawl Crochet Pattern with a lacy design, for a narrow asymmetric shawl. Perfect for that precious skein of Indie Dyed yarn.
one skeincrochet patternshawlfloraannie
https://crochetroo.blogspot.com/2010/02/charmed-prayer-shawl-crochet-pattern.html?showComment=1272025277654
crochetroo: Charmed Prayer Shawl Crochet Pattern
I have been asked by many people to write out the pattern for the prayer shawl above. While I have been away from my blog over the Christmas...
prayer shawlcharmedcrochetpattern
https://www.etabkh.com/2020/02/pearled-frost-shawl-knitting-pattern.html
E-Tab.KH: Food Recipes - Quilting - Knitting - Crochet: Pearled Frost Shawl - Knitting Pattern
Best FREE Crochet and Knitting Patterns and Tutorials, Easy Food Recipes, Quilting Patterns and Tutorials.
food recipes
https://crochetroo.blogspot.com/2010/02/charmed-prayer-shawl-crochet-pattern.html
crochetroo: Charmed Prayer Shawl Crochet Pattern
I have been asked by many people to write out the pattern for the prayer shawl above. While I have been away from my blog over the Christmas...
prayer shawlcharmedcrochetpattern
https://thefinickystitcher.com/product/70s-butterfly-shawl-crochet-pattern-for-women-wrap-shawl/
70s Butterfly Shawl Crochet Pattern for Women, Wrap Shawl | the finicky stitcher
Jul 29, 2025 - 1970s Vintage Butterfly Shawl Crochet Pattern: A dramatic butterfly crocheted in colors and then applied to the crocheted triangle back.
crochet patternfor womenbutterflyshawl
https://wogedesign.en.made-in-china.com/product/uQGrocIVgzhw/China-Factory-Vintage-Woven-Pattern-Keffiyeh-Muslim-Arabic-Windproof-Desert-Wrap-Shawl-Shemagh-Hijab-Square-Men-Tr-Cotton-Scarf.html
Factory Vintage Woven Pattern Keffiyeh Muslim Arabic Windproof Desert Wrap Shawl Shemagh Hijab...
Factory Vintage Woven Pattern Keffiyeh Muslim Arabic Windproof Desert Wrap Shawl Shemagh Hijab Square Men Tr Cotton Scarf, Find Details and Price about...
https://oombawkadesigncrochet.com/its-a-beautiful-day-shawl-pattern/
It's a Beautiful Day Shawl Pattern
Sep 11, 2025 - Wrap yourself in elegance with my It's a Beautiful Day shawl! Perfect for those breezy summer evenings. Made with Finesse Cotton Silk DK yarn
a beautiful dayshawlpattern
https://www.pickacraft.com/product/63519-53374/black-color-grid-pattern-shawl
Black Color Grid Pattern Shawl
Black Color Grid Pattern Shawl
black colorgridpatternshawl
https://knittingpattern.org/de-nada-shawl-free-knitting-pattern/
De Nada Shawl Free Knitting Pattern - Knitting Pattern
Apr 7, 2023 - De Nada Shawl Free Knitting Pattern
de nadafree knittingshawlpattern
https://telsatech.org/how-to-knit-rectangle-lace-shawl-shawl-of-solitaire-free-knitting-pattern-pattern-duchess/
How to knit rectangle lace shawl "Shawl of Solitaire" | Free knitting pattern | Pattern Duchess -...
Dec 4, 2021 - Pattern DuchessViews: 10718Like: 142Free written pattern and a chart available here: This lace shawl is without extra complicated details, but still
how to knitfree knitting pattern
https://yourcrochet.com/patterns/snow-drop-shawl-free-crochet-pattern/
Snow Drop Shawl Free Pattern - Your Crochet
Apr 28, 2025 - Explore the Snow Drop Shawl crochet pattern, a lovely accessory that combines simplicity and elegance with pointed petal edges.
free patternsnowdropshawlcrochet
https://www.kristinomdahl.com/2016-4-30-how-to-crochet-bruges-lace-in-a-spiral/
How to Crochet Bruges Lace in a Spiral Crochet Shawl Pattern by Kristin Omdahl | Kristin Omdahl
Feb 27, 2021 - Kristin Omdahl the latest in crochet and knitting patterns,and yarn. Purchase crochet and knit patterns and yarn for sale today.
how to crochet
https://www.kristinomdahl.com/layla-stitch-sampler-crochet-shawl-free-pattern-page/
Layla Stitch Sampler Crochet Shawl Free Pattern Page | Kristin Omdahl
Mar 20, 2022 - Kristin Omdahl the latest in crochet and knitting patterns,and yarn. Purchase crochet and knit patterns and yarn for sale today.
crochet shawlfree patternlaylastitchsampler
https://www.sunsetcat.com/2016/09/26/pattern-release-cayucos-shawl/
Pattern Release: Cayucos Shawl |
patternreleasecayucosshawl
https://www.etabkh.com/2020/04/anisah-shawl-knitting-pattern.html
E-Tab.KH: Food Recipes - Quilting - Knitting - Crochet: Anisah Shawl - Knitting Pattern
Best FREE Crochet and Knitting Patterns and Tutorials, Easy Food Recipes, Quilting Patterns and Tutorials.
food recipestabkh
https://uae.icarry.com/mix-pashmina-pattern-shawl-5
. Mix pashmina pattern shawl
mixpashminapatternshawl
https://www.allfreeknitting.com/Knit-Shawls/8-Hour-Lace-Shawl
8-Hour Lace Shawl Knitting Pattern | AllFreeKnitting.com
May 17, 2017 - This 8 Hour Lace Shawl is a great pattern that you can do in one weekend. It's a two-row lace knitting pattern, so even beginners can knit this!
knitting patternhourlaceshawl
https://www.crazypatterns.net/en/items/73715/fibonacci-shawl-knitting-pattern
Fibonacci Shawl Knitting Pattern
The Fibonacci Shawl is knitted from one lateral tip to the other. Across the length of the shawl a middle stitch pattern is worked. On the one side of the...
fibonaccishawlknittingpattern
https://www.yarnspirations.com/products/red-heart-simple-lace-triangle-shawl
Free Easy Red Heart Simple Lace Triangle Shawl Knitting Pattern | Yarnspirations
Find thousands of free easy knitting patterns at Yarnspirations, including the Red Heart Simple Lace Triangle Shawl. Explore over 10,000 free easy-to-follow...
red heartknitting patternfreeeasysimple
https://www.kristinomdahl.com/2017-7-27-fine-midsummer-garden-crescent-shaped-crochet-shawl-free-pattern/
Fine Midsummer Garden Crescent-Shaped Crochet Shawl Free Pattern | Kristin Omdahl
Mar 22, 2021 - Kristin Omdahl the latest in crochet and knitting patterns,and yarn. Purchase crochet and knit patterns and yarn for sale today.
crochet shawlfree patternfinemidsummergarden
https://aranpatternarchive.com/vintage-ladies-diamond-shawl-aran-cardigan/
Vintage Ladies Diamond Shawl Aran Cardigan - Aran Pattern Archive
vintageladiesdiamondshawlaran
https://lb.icarry.com/mix-pashmina-pattern-shawl-7
. Mix pashmina pattern shawl
mixpashminapatternshawl
https://www.thefemininetouchdesigns.co.uk/designingblog/read_156124/sometimes-you-learn-the-hard-way.html
Free Knitting Pattern | Semi Circular lace Shawl |
Lace charts and written instructions for a semi circular wide lace shawl. Designed and knit by The Feminine Touch Designs
free knitting patternsemicircularlaceshawl
https://massivecrochet.com/very-easy-crochet-pattern-for-beginners-unusual-crochet-stitch-for-baby-blanket-bag-and-shawl-1508
VERY EASY Crochet Pattern for Beginners - UNUSUAL Crochet Stitch for Baby Blanket, Bag and Shawl -...
Download this crochet pattern and embark on a creative journey where simplicity meets elegance in the most delightful way. Imagine holding your crochet hook,...
https://www.industrialwhimsy.net/product-page/pattern-booklet-hometown-shawl
Pattern Booklet Hometown Shawl | Industrial Whimsy
Half page booklet in full color on high quality paper. *****The Hometown Shawl evokes warm memories of returning home to find your favorite places and people...
patternbooklethometownshawlindustrial
https://yourcrochet.com/patterns/brown-butter-shawl-free-crochet-pattern/
Brown Butter Shawl Free Crochet Pattern - Your Crochet
Mar 18, 2025 - Explore the delightful Brown Butter Shawl crochet pattern by Tamara Kelly. Perfect for beginners, it uses simple stitches and bulky yarn.
free crochet patternbrown buttershawl
https://www.lovecrafts.com/en-au/p/maruv-crochet-boho-shawl-with-tassels-crochet-pattern-by-kyla-zoran
Maruv crochet boho shawl with tassels Crochet pattern by Kyla Zoran | LoveCrafts
Maruv crochet boho shawl with tassels is a Crochet pattern by Kyla Zoran, available as a Downloadable PDF and includes instructions in English. Discover more...
boho shawlcrochet
https://www.akaricrochetpatterns.com/2018/02/free-pattern-limited-time-countryside.html
FREE pattern (limited time): the COUNTRYSIDE DAY shawl_ C51
Free crochet patterns, tips, tutorials and news. Premium patterns for women and girls clothes and accesories.
free patternlimited timecountrysidedayshawl
https://forum.knittinghelp.com/t/looking-for-pattern-for-shawl-shown-on-photowall/65187
Looking for pattern for shawl shown on Photowall - General Knitting - KnittingHelp Forum Community
Nov 24, 2009 - Hi, all. I'm new here, just happened on to the site yesterday, and I really like it. I've been knitting and crocheting for years, but I taught myself and there...
looking for