Robuta

https://research.nvidia.com/labs/sil/ NVIDIA Spatial Intelligence Lab NVIDIA SIL: foundational tech enabling AI to perceive, model, and interact with the physical world. spatial intelligencenvidialab https://amorphsenses.com/ AMORPH.senses | Spatial Intelligence with LiDAR Feb 23, 2026 - AMORPH delivers advanced LiDAR-based 3D sensing solutions for traffic, airports, and industrial environments. Gain accurate, real-time spatial intelligence... spatial intelligenceamorphsenseslidar https://www.meetwhale.ai/ AI Audit Solutions for Real-Time Spatial Intelligence | Whale ai auditsolutions forreal timespatial intelligencewhale https://www.cupix.com/ Construction & Facility Management Spatial Intelligence Platform Transform 360° videos into actionable digital twins. Streamline site documentation, automate construction monitoring, and maintain complete maintenance records... facility managementspatial intelligenceconstructionplatform https://vantor.com/blog/vantor-rebrands-from-maxar-intelligence-unveils-ai-powered-platform/ Vantor: Formerly Maxar, New AI Spatial Intelligence Platform | Vantor Mar 24, 2026 - Vantor rebrands from Maxar Intelligence and launches Tensorglobe, an AI-powered spatial intelligence platform that connects sensors across space, air, and... new aispatial intelligencevantorformerlymaxar https://www.cognitivesystems.com/ Spatial Intelligence Platform using WiFi Motion Cognitive Systems Corp is a pioneer in Spatial Intelligence, transforming wireless signals into real-time understanding of physical spaces spatial intelligenceplatformusingwifimotion https://vantor.com/product/platform/nexus/ Nexus – Secure Spatial Intelligence Hosting | Vantor Built on the Vantor Tensorglobe platform, Vantor Nexus is a highly secure and configurable private runtime environment that hosts and deploys all your spatial... spatial intelligencenexussecurehostingvantor https://applanix.trimble.com/blog/applanix/en-US/tags/spatial-intelligence Tags: spatial-intelligence | Trimble Resource Center Resources tagged with spatial-intelligence spatial intelligencetagstrimbleresourcecenter https://my.archdaily.com/us/@abdullah-shadeed/folders/spatial-intelligence spatial intelligence by Abdullah Shadeed | ArchDaily spatial intelligence by Abdullah Shadeed - 1 Bookmarks spatial intelligenceabdullaharchdaily https://ssi.robotics.umich.edu/ Scalable Spatial Intelligence Lab Welcome! We are part of the Robotics Department at the University of Michigan. We create intelligent robotic systems that scale: in numbers, in endurance, and... spatial intelligencescalable https://repository.arizona.edu/handle/10150/186422?show=full Understanding spatial intelligence through problem-solving in art: An analysis of behaviors,... spatial intelligenceproblem solving https://research.nvidia.com/labs/sil/shared/index.html?target=4d-content NVIDIA Spatial Intelligence Lab (SIL) Advancing foundational technologies enabling AI systems to perceive, model, and interact with the physical world. spatial intelligence labnvidiasil https://www.siemens.com/en-gb/products/ttech-inc-dba-airia-airia-ai-spatial-intelligence/ AIRIA, AI Spatial Intelligence | Siemens AIRIA is a spatial intelligence software for universities, delivering real-time occupancy insights and campus-wide analytics. It reveals underused/overburden... spatial intelligenceairiasiemens https://www.ri.cmu.edu/event/vectorizing-raster-signals-for-spatial-intelligence/ Vectorizing Raster Signals for Spatial Intelligence - Robotics Institute Carnegie Mellon University Sep 11, 2024 - Abstract: This seminar will focus on how vectorized representations can be generated from raster signals to enhance spatial intelligence. I will discuss the... spatial intelligencerobotics institutecarnegie mellonvectorizingraster https://arxiv.org/abs/2507.18678 [2507.18678] Towards Scalable Spatial Intelligence via 2D-to-3D Data Lifting Abstract page for arXiv paper 2507.18678: Towards Scalable Spatial Intelligence via 2D-to-3D Data Lifting spatial intelligence https://www.siggis.be/ SIGGIS | Spatial Intelligence Genuine & Generic IT Solutions spatial intelligencegeneric itsiggisgenuinesolutions https://www.talkinglands.com/ TalkingLands — India's Spatial Intelligence Platform for Real Estate India's first parcel-level spatial intelligence platform. AI property reports, 40+ map layers, risk analysis. Trusted by Prestige Group. Get started for ₹100. spatial intelligencefor realindiaplatformestate https://drc.co/ Digital Reality Corp - Delivers Verified Spatial Intelligence Jul 7, 2026 - Learn about Digital Reality Corp and how it provides verified spatial intelligence for the built world in innovative ways. digital reality corpdeliversverifiedspatialintelligence https://meridianapi.com/ GIS Mapping, Location Intelligence, & Spatial Analytics Platform Location intelligence tools and apps for Ooh advertising, campaign management, and physical asset management. Learn more about using location data with... gis mappinglocation intelligencespatial analyticsplatform https://struct.inc/map/ Map Simulation Platform | Spatial Intelligence Create and simulate anything on a map and train autonomous systems. simulation platformmapspatialintelligence https://artilleryiq.com/ Spatial Computing Research & Insights - ARtillery Intelligence May 22, 2026 - ARtillery Intelligence is research and insights on augmented reality (AR), virtual reality (VR), extended reality (XR) and spatial computing. spatial computingresearch insightsartilleryintelligence https://www.deeyook.com/ Deeyook | Spatial AI for Real-World Intelligence Deeyook is a Spatial AI platform that transforms wireless signals into real-time spatial understanding across indoor and outdoor environments — without new... ai for realspatialworldintelligence https://engagevr.io/ Spatial Computing Artificial Intelligence - ENGAGE XR Jun 9, 2025 - For enterprise and education professionals seeking Spatial Computing, AI and Metaverse services for use in training, events, development, onboarding and... spatial computingartificial intelligenceengagexr https://vantor.com/ Vantor: Forging the new frontier of spatial intelligence Vantor is driving a more autonomous, interoperable world across the defense, intelligence, and commercial sectors. Our spatial intelligence products combine... the new frontiervantorforgingspatialintelligence https://qai.io/ QAI - AGI for Multimodal & Spatial Intelligence QAI is a world-class AI research lab pioneering multimodal intelligence and general AI. We build systems that understand, reason, and interact across all... qaiagimultimodalspatialintelligence https://huggingface.co/papers/2604.07296 Paper page - OpenSpatial: A Principled Data Engine for Empowering Spatial Intelligence Join the discussion on this paper page paper pagedata engineprincipled https://kempnerinstitute.harvard.edu/events/moira-dillon/ Developing Intelligence: Insights from Spatial and Social Cognition - Kempner Institute developing intelligenceand socialinsightsspatialcognition https://www.amazon.it/Spatial-Shift-convergenza-tecnologica-Intelligence-ebook/dp/B0D4BG33CZ?dib=eyJ2IjoiMSJ9._MDl4RRLwlxgrUJP7Ywy7L3aL7mUnxHFlfzysWHIi9ur7p4nwunZ18__9k_n5Iipltgx2CIIYyMoKIW1U2i3RQ.8kV7dFMToBVptwkH-GEH3lHCxcLHV-0uEl1VbzOgkco&dib_tag=se&qid=1720608541&refinements=p_27:Fabio+Lalli&s=digital-text&sr=1-1&text=Fabio+Lalli&linkCode=sl1&tag=mtvrs-21&linkId=bf15ceca03b764ac61dd62c3d727fe08&language=it_IT&ref_=as_li_ss_tl Spatial Shift: La convergenza tecnologica di Computing, Mixed Reality, Artificial Intelligence e... Spatial Shift: La convergenza tecnologica di Computing, Mixed Reality, Artificial Intelligence e Blockchain eBook : Lalli, Fabio: Amazon.it: Libri https://sema.airi.net/ Spatial Epitope Modelling with Artificial intelligence - SEMA artificial intelligencespatialepitopemodellingsema https://www.spatialrisksystems.com/ Spatial Risk Systems — Facility-Level Risk Intelligence Spatial Risk Systems — Facility-Level Geospatial Risk Intelligence. Asset-level climate, environmental and supply chain risk analytics for financial... spatialrisksystemsfacilitylevel https://pubmed.ncbi.nlm.nih.gov/35765645/ Emerging artificial intelligence applications in Spatial Transcriptomics analysis Spatial transcriptomics (ST) has advanced significantly in the last few years. Such advancement comes with the urgent need for novel computational methods to... artificial intelligencespatial transcriptomicsemergingapplicationsanalysis https://voxelspace.com/ Voxel Space | Volumetric Digital Twin Platform for 4D Spatial Intelligence Voxel Space is a volumetric Digital Twin platform that transforms LiDAR, seismic, and geospatial data into intelligent 4D voxel models. Visualize below the... digital twin platformvoxelspacevolumetricspatial https://www.esri.com/en-us/industries/technology/overview BI for High-Tech | Spatial business intelligence for software and technology companies Spatial business intelligence solutions to strengthen strategic business growth by optimizing facilities management, data centers infrastructure, IT networks... software and technologybusiness intelligencebihighspatial https://www.esri.com/about/newsroom/announcements/esri-location-intelligence-to-integrate-with-sap-hana-spatial-services Esri Location Intelligence to Integrate with SAP HANA Spatial Services - Esri Aug 13, 2019 - Esri Selected as the Preferred Geospatial Technology Provider for New SAP Offering location intelligencesap hanaesriintegratespatial https://eric.ed.gov/?id=EJ267776 ERIC - EJ267776 - Spatial Ability and Handedness., Intelligence, 1982 The relationships among preferred handedness, family history of sinistrality, sex of subject, and spatial visualization were examined in college students.... ericspatialabilityhandednessintelligence https://dornsife.usc.edu/spatial/undergraduate/b-s-human-security-and-geospatial-intelligence/ B.S. Human Security and Geospatial Intelligence - Spatial Sciences Institute May 4, 2026 - USC Dornsife Spatial Sciences Institute b shuman securitygeospatial intelligencesciencesinstitute https://bsos.umd.edu/event/geoai-spatial-questions-geospatial-intelligence-hybrid GeoAI: From Spatial Questions to Geospatial Intelligence (Hybrid) | The College of Behavioral and... https://mediaspace.esri.com/media/t/1_kbb2pme2 Exploring Spatial Relationships for Intelligence Operations - Esri Videos: GIS, Events, ArcGIS... intelligence operationsexploringspatialrelationships https://isprs-archives.copernicus.org/articles/XLVIII-4-2024/233/2024/isprs-archives-XLVIII-4-2024-233-2024.html ISPRS-Archives - The Framework of GeoSOT-3D Grid Modeling for Spatial Artificial Intelligence https://www.esri.ca/en-ca/home Esri Canada | GIS Mapping, Spatial Analytics and Location Intelligence Solutions Provider Esri Canada’s geographic information system (GIS) solutions enable informed decisions by leveraging mapping, spatial analytics and location intelligence. gis mappingspatial analyticslocation intelligenceesricanada